Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1949949..1950628 | Replicon | chromosome |
| Accession | NZ_CP100305 | ||
| Organism | Acinetobacter baumannii strain KBN10P05679 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | NIK71_RS09390 | Protein ID | WP_000838146.1 |
| Coordinates | 1950446..1950628 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | NIK71_RS09385 | Protein ID | WP_000966688.1 |
| Coordinates | 1949949..1950353 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIK71_RS09375 (NIK71_09375) | 1948652..1949029 | - | 378 | WP_016062490.1 | hypothetical protein | - |
| NIK71_RS09380 (NIK71_09380) | 1949095..1949856 | - | 762 | WP_000910437.1 | hypothetical protein | - |
| NIK71_RS09385 (NIK71_09385) | 1949949..1950353 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIK71_RS09390 (NIK71_09390) | 1950446..1950628 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIK71_RS09395 (NIK71_09395) | 1950954..1951469 | - | 516 | WP_038346477.1 | hypothetical protein | - |
| NIK71_RS09400 (NIK71_09400) | 1951539..1952456 | - | 918 | WP_000094260.1 | phage tail tube protein | - |
| NIK71_RS09405 (NIK71_09405) | 1952553..1953701 | - | 1149 | WP_070423372.1 | phage tail protein | - |
| NIK71_RS09410 (NIK71_09410) | 1953701..1954054 | - | 354 | WP_015451444.1 | hypothetical protein | - |
| NIK71_RS09415 (NIK71_09415) | 1954150..1954368 | - | 219 | WP_070423369.1 | hypothetical protein | - |
| NIK71_RS09420 (NIK71_09420) | 1954370..1954768 | - | 399 | WP_001251850.1 | phage tail terminator-like protein | - |
| NIK71_RS09425 (NIK71_09425) | 1954770..1955138 | - | 369 | WP_002055488.1 | hypothetical protein | - |
| NIK71_RS09430 (NIK71_09430) | 1955110..1955514 | - | 405 | WP_000247948.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1933751..2034913 | 101162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T250401 WP_000838146.1 NZ_CP100305:c1950628-1950446 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT250401 WP_000966688.1 NZ_CP100305:c1950353-1949949 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|