Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 132993..133630 Replicon plasmid p81s2p
Accession NZ_CP100302
Organism Burkholderia glumae strain BGR81S

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIY08_RS30305 Protein ID WP_012735347.1
Coordinates 132993..133394 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIY08_RS30310 Protein ID WP_012735348.1
Coordinates 133394..133630 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY08_RS30275 129456..129725 + 270 WP_012735343.1 hypothetical protein -
NIY08_RS30280 129885..130499 + 615 Protein_101 error-prone DNA polymerase -
NIY08_RS30285 130515..130802 + 288 WP_012735344.1 hypothetical protein -
NIY08_RS30290 131906..132100 - 195 WP_124837731.1 hypothetical protein -
NIY08_RS30295 132155..132397 - 243 WP_012735345.1 hypothetical protein -
NIY08_RS30300 132415..132744 - 330 WP_155297075.1 hypothetical protein -
NIY08_RS30305 132993..133394 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIY08_RS30310 133394..133630 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIY08_RS30315 133967..134656 - 690 WP_257739423.1 hypothetical protein -
NIY08_RS30320 134743..136569 - 1827 WP_012735349.1 site-specific integrase -
NIY08_RS30325 136566..136946 - 381 WP_080569442.1 hypothetical protein -
NIY08_RS30330 136949..137266 - 318 WP_050811486.1 hypothetical protein -
NIY08_RS30335 137317..138405 - 1089 Protein_112 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..141000 141000


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250398 WP_012735347.1 NZ_CP100302:c133394-132993 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250398 WP_012735348.1 NZ_CP100302:c133630-133394 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References