Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5688452..5689056 | Replicon | chromosome |
| Accession | NZ_CP100300 | ||
| Organism | Burkholderia glumae strain BGR81S | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIY08_RS25230 | Protein ID | WP_017922254.1 |
| Coordinates | 5688452..5688634 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIY08_RS25235 | Protein ID | WP_017922253.1 |
| Coordinates | 5688661..5689056 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY08_RS25205 | 5684256..5684504 | - | 249 | WP_039201402.1 | gpW family head-tail joining protein | - |
| NIY08_RS25210 | 5684521..5686593 | - | 2073 | WP_257755350.1 | phage terminase large subunit family protein | - |
| NIY08_RS25215 | 5686646..5687350 | - | 705 | WP_251107513.1 | hypothetical protein | - |
| NIY08_RS25220 | 5687400..5687675 | - | 276 | WP_257834622.1 | DUF2591 domain-containing protein | - |
| NIY08_RS25225 | 5687681..5688379 | - | 699 | WP_257834624.1 | hypothetical protein | - |
| NIY08_RS25230 | 5688452..5688634 | + | 183 | WP_017922254.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIY08_RS25235 | 5688661..5689056 | + | 396 | WP_017922253.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIY08_RS25240 | 5689353..5689784 | - | 432 | WP_157384052.1 | hypothetical protein | - |
| NIY08_RS25245 | 5689777..5690340 | - | 564 | WP_257834627.1 | hypothetical protein | - |
| NIY08_RS25250 | 5690508..5690828 | - | 321 | WP_124837795.1 | hypothetical protein | - |
| NIY08_RS25255 | 5690856..5692655 | - | 1800 | WP_124837793.1 | toprim domain-containing protein | - |
| NIY08_RS25260 | 5692652..5693104 | - | 453 | WP_051415274.1 | HNH endonuclease signature motif containing protein | - |
| NIY08_RS25265 | 5693101..5693982 | - | 882 | WP_257756926.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5606145..5709529 | 103384 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6599.76 Da Isoelectric Point: 11.2641
>T250397 WP_017922254.1 NZ_CP100300:5688452-5688634 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14466.21 Da Isoelectric Point: 4.5532
>AT250397 WP_017922253.1 NZ_CP100300:5688661-5689056 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|