Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 5688452..5689056 Replicon chromosome
Accession NZ_CP100300
Organism Burkholderia glumae strain BGR81S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIY08_RS25230 Protein ID WP_017922254.1
Coordinates 5688452..5688634 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIY08_RS25235 Protein ID WP_017922253.1
Coordinates 5688661..5689056 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY08_RS25205 5684256..5684504 - 249 WP_039201402.1 gpW family head-tail joining protein -
NIY08_RS25210 5684521..5686593 - 2073 WP_257755350.1 phage terminase large subunit family protein -
NIY08_RS25215 5686646..5687350 - 705 WP_251107513.1 hypothetical protein -
NIY08_RS25220 5687400..5687675 - 276 WP_257834622.1 DUF2591 domain-containing protein -
NIY08_RS25225 5687681..5688379 - 699 WP_257834624.1 hypothetical protein -
NIY08_RS25230 5688452..5688634 + 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIY08_RS25235 5688661..5689056 + 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIY08_RS25240 5689353..5689784 - 432 WP_157384052.1 hypothetical protein -
NIY08_RS25245 5689777..5690340 - 564 WP_257834627.1 hypothetical protein -
NIY08_RS25250 5690508..5690828 - 321 WP_124837795.1 hypothetical protein -
NIY08_RS25255 5690856..5692655 - 1800 WP_124837793.1 toprim domain-containing protein -
NIY08_RS25260 5692652..5693104 - 453 WP_051415274.1 HNH endonuclease signature motif containing protein -
NIY08_RS25265 5693101..5693982 - 882 WP_257756926.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5606145..5709529 103384


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250397 WP_017922254.1 NZ_CP100300:5688452-5688634 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250397 WP_017922253.1 NZ_CP100300:5688661-5689056 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References