Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 251009..251646 Replicon plasmid psl2395s1p
Accession NZ_CP100298
Organism Burkholderia glumae strain SL-2395S

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIX96_RS31165 Protein ID WP_012735347.1
Coordinates 251009..251410 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIX96_RS31170 Protein ID WP_017924531.1
Coordinates 251410..251646 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX96_RS31120 246299..246520 - 222 WP_017433768.1 hypothetical protein -
NIX96_RS31125 246670..246864 - 195 WP_124837685.1 hypothetical protein -
NIX96_RS31130 246923..247273 - 351 WP_012734107.1 type II toxin-antitoxin system ChpB family toxin -
NIX96_RS31135 247267..247518 - 252 WP_012734108.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
NIX96_RS31140 247781..247975 - 195 WP_257835400.1 hypothetical protein -
NIX96_RS31145 248078..248806 - 729 WP_257835401.1 IS6 family transposase -
NIX96_RS31155 250171..250413 - 243 WP_039205039.1 hypothetical protein -
NIX96_RS31160 250431..250760 - 330 WP_155297075.1 hypothetical protein -
NIX96_RS31165 251009..251410 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIX96_RS31170 251410..251646 - 237 WP_017924531.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIX96_RS31175 251783..252442 - 660 WP_161522132.1 tyrosine-type recombinase/integrase -
NIX96_RS31180 252557..252847 - 291 WP_161522133.1 hypothetical protein -
NIX96_RS31185 252887..253054 - 168 WP_174525173.1 hypothetical protein -
NIX96_RS31190 253423..254220 - 798 WP_012732720.1 IS21-like element helper ATPase IstB -
NIX96_RS31195 254213..255718 - 1506 WP_012732721.1 IS21 family transposase -
NIX96_RS31200 255832..256212 - 381 Protein_265 low affinity iron permease family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..269922 269922
- inside IScluster/Tn - - 248915..255727 6812


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250394 WP_012735347.1 NZ_CP100298:c251410-251009 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8965.10 Da        Isoelectric Point: 6.3676

>AT250394 WP_017924531.1 NZ_CP100298:c251646-251410 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGL

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure

References