Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 251009..251646 | Replicon | plasmid psl2395s1p |
| Accession | NZ_CP100298 | ||
| Organism | Burkholderia glumae strain SL-2395S | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | C5AP38 |
| Locus tag | NIX96_RS31165 | Protein ID | WP_012735347.1 |
| Coordinates | 251009..251410 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIX96_RS31170 | Protein ID | WP_017924531.1 |
| Coordinates | 251410..251646 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX96_RS31120 | 246299..246520 | - | 222 | WP_017433768.1 | hypothetical protein | - |
| NIX96_RS31125 | 246670..246864 | - | 195 | WP_124837685.1 | hypothetical protein | - |
| NIX96_RS31130 | 246923..247273 | - | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | - |
| NIX96_RS31135 | 247267..247518 | - | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| NIX96_RS31140 | 247781..247975 | - | 195 | WP_257835400.1 | hypothetical protein | - |
| NIX96_RS31145 | 248078..248806 | - | 729 | WP_257835401.1 | IS6 family transposase | - |
| NIX96_RS31155 | 250171..250413 | - | 243 | WP_039205039.1 | hypothetical protein | - |
| NIX96_RS31160 | 250431..250760 | - | 330 | WP_155297075.1 | hypothetical protein | - |
| NIX96_RS31165 | 251009..251410 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIX96_RS31170 | 251410..251646 | - | 237 | WP_017924531.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIX96_RS31175 | 251783..252442 | - | 660 | WP_161522132.1 | tyrosine-type recombinase/integrase | - |
| NIX96_RS31180 | 252557..252847 | - | 291 | WP_161522133.1 | hypothetical protein | - |
| NIX96_RS31185 | 252887..253054 | - | 168 | WP_174525173.1 | hypothetical protein | - |
| NIX96_RS31190 | 253423..254220 | - | 798 | WP_012732720.1 | IS21-like element helper ATPase IstB | - |
| NIX96_RS31195 | 254213..255718 | - | 1506 | WP_012732721.1 | IS21 family transposase | - |
| NIX96_RS31200 | 255832..256212 | - | 381 | Protein_265 | low affinity iron permease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..269922 | 269922 | |
| - | inside | IScluster/Tn | - | - | 248915..255727 | 6812 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T250394 WP_012735347.1 NZ_CP100298:c251410-251009 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|