Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-ChpS
Location 246923..247518 Replicon plasmid psl2395s1p
Accession NZ_CP100298
Organism Burkholderia glumae strain SL-2395S

Toxin (Protein)


Gene name chpB Uniprot ID C5AN78
Locus tag NIX96_RS31130 Protein ID WP_012734107.1
Coordinates 246923..247273 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID C5AN79
Locus tag NIX96_RS31135 Protein ID WP_012734108.1
Coordinates 247267..247518 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX96_RS31105 242145..242891 - 747 WP_232252306.1 energy transducer TonB -
NIX96_RS31110 242923..245310 - 2388 WP_051071184.1 TonB-dependent receptor -
NIX96_RS31115 245612..246076 - 465 WP_012734106.1 Lrp/AsnC family transcriptional regulator -
NIX96_RS31120 246299..246520 - 222 WP_017433768.1 hypothetical protein -
NIX96_RS31125 246670..246864 - 195 WP_124837685.1 hypothetical protein -
NIX96_RS31130 246923..247273 - 351 WP_012734107.1 type II toxin-antitoxin system ChpB family toxin Toxin
NIX96_RS31135 247267..247518 - 252 WP_012734108.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIX96_RS31140 247781..247975 - 195 WP_257835400.1 hypothetical protein -
NIX96_RS31145 248078..248806 - 729 WP_257835401.1 IS6 family transposase -
NIX96_RS31155 250171..250413 - 243 WP_039205039.1 hypothetical protein -
NIX96_RS31160 250431..250760 - 330 WP_155297075.1 hypothetical protein -
NIX96_RS31165 251009..251410 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin -
NIX96_RS31170 251410..251646 - 237 WP_017924531.1 type II toxin-antitoxin system VapB family antitoxin -
NIX96_RS31175 251783..252442 - 660 WP_161522132.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..269922 269922
- inside IScluster/Tn - - 248915..255727 6812


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(8-114)

Antitoxin

Antitoxin PemI-like

(1-83)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12389.37 Da        Isoelectric Point: 8.8909

>T250393 WP_012734107.1 NZ_CP100298:c247273-246923 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 8940.31 Da        Isoelectric Point: 6.2420

>AT250393 WP_012734108.1 NZ_CP100298:c247518-247267 [Burkholderia glumae]
MELKIQKWGNSAAVRLPSVLLEQINASVGGSLNADVRPDGVLLTPARRKYALDDLVAQCDTKAPVPADMAAWGEIKPVGR
EAW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246MF70

Antitoxin

Source ID Structure
AlphaFold DB A0A246MFN5

References