Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1103704..1104479 | Replicon | chromosome |
Accession | NZ_CP100297 | ||
Organism | Burkholderia glumae strain SL-2395S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NIX96_RS22720 | Protein ID | WP_017423245.1 |
Coordinates | 1103982..1104479 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | NIX96_RS22715 | Protein ID | WP_017423246.1 |
Coordinates | 1103704..1103985 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX96_RS22705 | 1101686..1102123 | + | 438 | WP_159372664.1 | SMI1/KNR4 family protein | - |
NIX96_RS22710 | 1102247..1103484 | + | 1238 | WP_088499505.1 | IS3-like element IS1416 family transposase | - |
NIX96_RS22715 | 1103704..1103985 | + | 282 | WP_017423246.1 | DUF1778 domain-containing protein | Antitoxin |
NIX96_RS22720 | 1103982..1104479 | + | 498 | WP_017423245.1 | GNAT family N-acetyltransferase | Toxin |
NIX96_RS22725 | 1104560..1105057 | + | 498 | WP_251107809.1 | ProQ/FINO family protein | - |
NIX96_RS22730 | 1105473..1106078 | + | 606 | Protein_986 | RHS repeat-associated core domain-containing protein | - |
NIX96_RS22735 | 1106214..1106456 | + | 243 | WP_257757996.1 | TIGR02269 family lipoprotein | - |
NIX96_RS22740 | 1106473..1106757 | + | 285 | WP_153478924.1 | hypothetical protein | - |
NIX96_RS22745 | 1106880..1107425 | + | 546 | Protein_989 | IS3 family transposase | - |
NIX96_RS22750 | 1107497..1107592 | + | 96 | Protein_990 | IS5/IS1182 family transposase | - |
NIX96_RS22755 | 1107678..1109027 | - | 1350 | WP_017424540.1 | allantoin permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fliC | 1083938..1119110 | 35172 | |
- | inside | IScluster/Tn | - | - | 1102247..1107449 | 5202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17606.19 Da Isoelectric Point: 9.6894
>T250392 WP_017423245.1 NZ_CP100297:1103982-1104479 [Burkholderia glumae]
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|