Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2902131..2902735 | Replicon | chromosome |
Accession | NZ_CP100296 | ||
Organism | Burkholderia glumae strain SL-2395S |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NIX96_RS13760 | Protein ID | WP_017922254.1 |
Coordinates | 2902131..2902313 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NIX96_RS13765 | Protein ID | WP_017922253.1 |
Coordinates | 2902340..2902735 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX96_RS13730 | 2897616..2897864 | - | 249 | WP_039201402.1 | gpW family head-tail joining protein | - |
NIX96_RS13735 | 2897881..2899953 | - | 2073 | WP_257834958.1 | phage terminase large subunit family protein | - |
NIX96_RS13740 | 2900006..2900710 | - | 705 | WP_251107513.1 | hypothetical protein | - |
NIX96_RS13745 | 2900760..2901005 | - | 246 | WP_254983853.1 | hypothetical protein | - |
NIX96_RS13750 | 2901154..2901354 | - | 201 | WP_124837747.1 | DUF2591 family protein | - |
NIX96_RS13755 | 2901360..2902058 | - | 699 | WP_257818528.1 | hypothetical protein | - |
NIX96_RS13760 | 2902131..2902313 | + | 183 | WP_017922254.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NIX96_RS13765 | 2902340..2902735 | + | 396 | WP_017922253.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NIX96_RS13770 | 2903032..2903463 | - | 432 | WP_157384052.1 | hypothetical protein | - |
NIX96_RS13775 | 2903456..2904049 | - | 594 | WP_254983860.1 | hypothetical protein | - |
NIX96_RS13780 | 2904568..2905410 | - | 843 | WP_257835068.1 | toprim domain-containing protein | - |
NIX96_RS13785 | 2905397..2906944 | - | 1548 | WP_257835069.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6599.76 Da Isoelectric Point: 11.2641
>T250391 WP_017922254.1 NZ_CP100296:2902131-2902313 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14466.21 Da Isoelectric Point: 4.5532
>AT250391 WP_017922253.1 NZ_CP100296:2902340-2902735 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|