Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2211248..2211852 Replicon chromosome
Accession NZ_CP100296
Organism Burkholderia glumae strain SL-2395S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIX96_RS10370 Protein ID WP_257834960.1
Coordinates 2211248..2211430 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIX96_RS10375 Protein ID WP_017922253.1
Coordinates 2211457..2211852 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX96_RS10340 2206733..2206981 - 249 WP_039201402.1 gpW family head-tail joining protein -
NIX96_RS10345 2206998..2209070 - 2073 WP_257834958.1 phage terminase large subunit family protein -
NIX96_RS10350 2209123..2209827 - 705 WP_251107513.1 hypothetical protein -
NIX96_RS10355 2209877..2210122 - 246 WP_257834959.1 hypothetical protein -
NIX96_RS10360 2210271..2210471 - 201 WP_124837747.1 DUF2591 family protein -
NIX96_RS10365 2210477..2211097 - 621 WP_257744546.1 hypothetical protein -
NIX96_RS10370 2211248..2211430 + 183 WP_257834960.1 type II toxin-antitoxin system HicA family toxin Toxin
NIX96_RS10375 2211457..2211852 + 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIX96_RS10380 2212294..2212527 + 234 WP_257803289.1 hypothetical protein -
NIX96_RS10385 2213613..2214044 - 432 WP_257744544.1 hypothetical protein -
NIX96_RS10390 2214037..2214600 - 564 WP_257744543.1 hypothetical protein -
NIX96_RS10395 2214614..2214832 - 219 WP_017922250.1 hypothetical protein -
NIX96_RS10400 2214879..2215388 - 510 WP_257744542.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2180333..2228149 47816


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6614.73 Da        Isoelectric Point: 11.2641

>T250390 WP_257834960.1 NZ_CP100296:2211248-2211430 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250390 WP_017922253.1 NZ_CP100296:2211457-2211852 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References