Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 111828..112465 | Replicon | plasmid pr22p |
| Accession | NZ_CP100294 | ||
| Organism | Burkholderia glumae strain R2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | C5AP38 |
| Locus tag | NIX97_RS30000 | Protein ID | WP_012735347.1 |
| Coordinates | 111828..112229 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIX97_RS30005 | Protein ID | WP_017924531.1 |
| Coordinates | 112229..112465 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX97_RS29970 | 108741..109469 | - | 729 | WP_257804669.1 | IS6 family transposase | - |
| NIX97_RS29975 | 109510..109869 | + | 360 | Protein_110 | OB-fold nucleic acid binding domain-containing protein | - |
| NIX97_RS29980 | 109882..110169 | + | 288 | WP_176359098.1 | hypothetical protein | - |
| NIX97_RS29985 | 110435..110629 | - | 195 | WP_124837731.1 | hypothetical protein | - |
| NIX97_RS29990 | 110990..111232 | - | 243 | WP_039205039.1 | hypothetical protein | - |
| NIX97_RS29995 | 111250..111579 | - | 330 | WP_155297075.1 | hypothetical protein | - |
| NIX97_RS30000 | 111828..112229 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIX97_RS30005 | 112229..112465 | - | 237 | WP_017924531.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIX97_RS30010 | 113024..114528 | - | 1505 | Protein_117 | IS21 family transposase | - |
| NIX97_RS30015 | 114620..116371 | - | 1752 | WP_257804676.1 | S8 family peptidase | - |
| NIX97_RS30020 | 116381..117364 | - | 984 | WP_012732876.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..152564 | 152564 | |
| - | inside | IScluster/Tn | - | - | 106963..113941 | 6978 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T250389 WP_012735347.1 NZ_CP100294:c112229-111828 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|