Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-MazE |
Location | 2501996..2502591 | Replicon | chromosome |
Accession | NZ_CP100292 | ||
Organism | Burkholderia glumae strain R2 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | - |
Locus tag | NIX97_RS27600 | Protein ID | WP_017425281.1 |
Coordinates | 2502241..2502591 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | - |
Locus tag | NIX97_RS27595 | Protein ID | WP_017425280.1 |
Coordinates | 2501996..2502247 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX97_RS27565 | 2497270..2497755 | + | 486 | WP_257758079.1 | type II secretion system minor pseudopilin GspI | - |
NIX97_RS27570 | 2497739..2498146 | - | 408 | WP_157384246.1 | hypothetical protein | - |
NIX97_RS27580 | 2499188..2499993 | + | 806 | WP_257757722.1 | IS5 family transposase | - |
NIX97_RS27585 | 2500107..2500772 | - | 666 | WP_257804045.1 | hypothetical protein | - |
NIX97_RS27590 | 2501056..2501784 | + | 729 | WP_257804046.1 | IS6 family transposase | - |
NIX97_RS27595 | 2501996..2502247 | + | 252 | WP_017425280.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NIX97_RS27600 | 2502241..2502591 | + | 351 | WP_017425281.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
NIX97_RS27605 | 2502654..2502866 | + | 213 | WP_236577911.1 | hypothetical protein | - |
NIX97_RS27610 | 2502925..2503119 | + | 195 | WP_159372711.1 | hypothetical protein | - |
NIX97_RS27615 | 2503196..2503408 | + | 213 | WP_017425283.1 | hypothetical protein | - |
NIX97_RS27620 | 2503425..2503673 | + | 249 | WP_017425284.1 | hypothetical protein | - |
NIX97_RS27625 | 2503797..2504525 | - | 729 | WP_159372712.1 | IS6 family transposase | - |
NIX97_RS27630 | 2504870..2507224 | - | 2355 | WP_257804048.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2497306..2521843 | 24537 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12420.39 Da Isoelectric Point: 8.6592
>T250388 WP_017425281.1 NZ_CP100292:2502241-2502591 [Burkholderia glumae]
MVKRVKFERGDIVRVSLNPTMGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLEARGARKIERAPVEVVEDALARLQTILE
MVKRVKFERGDIVRVSLNPTMGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLEARGARKIERAPVEVVEDALARLQTILE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|