Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1055563..1056338 | Replicon | chromosome |
| Accession | NZ_CP100292 | ||
| Organism | Burkholderia glumae strain R2 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | NIX97_RS21825 | Protein ID | WP_017423245.1 |
| Coordinates | 1055841..1056338 (+) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | - |
| Locus tag | NIX97_RS21820 | Protein ID | WP_017423246.1 |
| Coordinates | 1055563..1055844 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX97_RS21810 | 1053545..1053982 | + | 438 | WP_159372664.1 | SMI1/KNR4 family protein | - |
| NIX97_RS21815 | 1054106..1055343 | + | 1238 | WP_088499505.1 | IS3-like element IS1416 family transposase | - |
| NIX97_RS21820 | 1055563..1055844 | + | 282 | WP_017423246.1 | DUF1778 domain-containing protein | Antitoxin |
| NIX97_RS21825 | 1055841..1056338 | + | 498 | WP_017423245.1 | GNAT family N-acetyltransferase | Toxin |
| NIX97_RS21830 | 1056419..1056916 | + | 498 | WP_251107809.1 | ProQ/FINO family protein | - |
| NIX97_RS21835 | 1057332..1057937 | + | 606 | Protein_924 | RHS repeat-associated core domain-containing protein | - |
| NIX97_RS21840 | 1058073..1058315 | + | 243 | WP_257757996.1 | TIGR02269 family lipoprotein | - |
| NIX97_RS21845 | 1058332..1058616 | + | 285 | WP_153478924.1 | hypothetical protein | - |
| NIX97_RS21850 | 1058739..1059284 | + | 546 | Protein_927 | IS3 family transposase | - |
| NIX97_RS21855 | 1059356..1059451 | + | 96 | Protein_928 | IS5/IS1182 family transposase | - |
| NIX97_RS21860 | 1059537..1060886 | - | 1350 | WP_017424540.1 | allantoin permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fliC | 1037489..1070969 | 33480 | |
| - | inside | IScluster/Tn | - | - | 1054106..1059308 | 5202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17606.19 Da Isoelectric Point: 9.6894
>T250387 WP_017423245.1 NZ_CP100292:1055841-1056338 [Burkholderia glumae]
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRSLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|