Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2841465..2842069 Replicon chromosome
Accession NZ_CP100291
Organism Burkholderia glumae strain R2

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIX97_RS13450 Protein ID WP_017922254.1
Coordinates 2841887..2842069 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIX97_RS13445 Protein ID WP_017922253.1
Coordinates 2841465..2841860 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX97_RS13415 2836534..2838489 - 1956 WP_257803393.1 glycoside hydrolase family 55 protein -
NIX97_RS13420 2838502..2838726 - 225 WP_257803395.1 hypothetical protein -
NIX97_RS13425 2838739..2839635 - 897 WP_257803396.1 hypothetical protein -
NIX97_RS13430 2839654..2840097 - 444 WP_257803711.1 DUF2313 domain-containing protein -
NIX97_RS13435 2840175..2840924 - 750 WP_257803397.1 hypothetical protein -
NIX97_RS13440 2840890..2841168 + 279 WP_257803399.1 hypothetical protein -
NIX97_RS13445 2841465..2841860 - 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIX97_RS13450 2841887..2842069 - 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIX97_RS13455 2842220..2842723 + 504 WP_251118898.1 DUF2591 family protein -
NIX97_RS13460 2842910..2843752 - 843 WP_251118900.1 toprim domain-containing protein -
NIX97_RS13465 2843739..2845286 - 1548 WP_251118901.1 DEAD/DEAH box helicase family protein -
NIX97_RS13470 2845279..2846181 - 903 WP_251118902.1 ParB N-terminal domain-containing protein -
NIX97_RS13475 2846239..2846559 - 321 WP_251118903.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2810674..2860076 49402


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250386 WP_017922254.1 NZ_CP100291:c2842069-2841887 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250386 WP_017922253.1 NZ_CP100291:c2841860-2841465 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References