Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2508836..2509440 | Replicon | chromosome |
| Accession | NZ_CP100291 | ||
| Organism | Burkholderia glumae strain R2 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIX97_RS11725 | Protein ID | WP_017922254.1 |
| Coordinates | 2508836..2509018 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIX97_RS11730 | Protein ID | WP_017922253.1 |
| Coordinates | 2509045..2509440 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX97_RS11695 | 2504321..2504569 | - | 249 | WP_039201402.1 | gpW family head-tail joining protein | - |
| NIX97_RS11700 | 2504586..2506658 | - | 2073 | WP_257756915.1 | phage terminase large subunit family protein | - |
| NIX97_RS11705 | 2506711..2507415 | - | 705 | WP_251107513.1 | hypothetical protein | - |
| NIX97_RS11710 | 2507465..2507710 | - | 246 | WP_039201374.1 | hypothetical protein | - |
| NIX97_RS11715 | 2507697..2508059 | - | 363 | WP_039201376.1 | DUF2591 family protein | - |
| NIX97_RS11720 | 2508065..2508685 | - | 621 | WP_039201377.1 | hypothetical protein | - |
| NIX97_RS11725 | 2508836..2509018 | + | 183 | WP_017922254.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIX97_RS11730 | 2509045..2509440 | + | 396 | WP_017922253.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIX97_RS11735 | 2509882..2510115 | + | 234 | WP_257803289.1 | hypothetical protein | - |
| NIX97_RS11740 | 2511201..2511632 | - | 432 | WP_257744544.1 | hypothetical protein | - |
| NIX97_RS11745 | 2511625..2512218 | - | 594 | WP_257803290.1 | hypothetical protein | - |
| NIX97_RS11750 | 2512737..2513579 | - | 843 | WP_257803291.1 | toprim domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2480404..2524393 | 43989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6599.76 Da Isoelectric Point: 11.2641
>T250385 WP_017922254.1 NZ_CP100291:2508836-2509018 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14466.21 Da Isoelectric Point: 4.5532
>AT250385 WP_017922253.1 NZ_CP100291:2509045-2509440 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|