Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2221837..2222441 Replicon chromosome
Accession NZ_CP100291
Organism Burkholderia glumae strain R2

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIX97_RS10355 Protein ID WP_017922254.1
Coordinates 2221837..2222019 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIX97_RS10360 Protein ID WP_257803264.1
Coordinates 2222046..2222441 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX97_RS10325 2217321..2217569 - 249 WP_039201402.1 gpW family head-tail joining protein -
NIX97_RS10330 2217586..2219658 - 2073 WP_257803261.1 phage terminase large subunit family protein -
NIX97_RS10335 2219711..2220415 - 705 WP_257803262.1 hypothetical protein -
NIX97_RS10340 2220466..2220711 - 246 WP_039201374.1 hypothetical protein -
NIX97_RS10345 2220698..2221060 - 363 WP_039201376.1 DUF2591 family protein -
NIX97_RS10350 2221066..2221686 - 621 WP_257803263.1 hypothetical protein -
NIX97_RS10355 2221837..2222019 + 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIX97_RS10360 2222046..2222441 + 396 WP_257803264.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIX97_RS10365 2222659..2222964 + 306 WP_257756922.1 hypothetical protein -
NIX97_RS10370 2222968..2223147 - 180 WP_257803265.1 hypothetical protein -
NIX97_RS10375 2223732..2224052 - 321 WP_186125690.1 hypothetical protein -
NIX97_RS10380 2224080..2225876 - 1797 WP_186125688.1 toprim domain-containing protein -
NIX97_RS10385 2225873..2226838 - 966 WP_257803266.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2193105..2238601 45496


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250384 WP_017922254.1 NZ_CP100291:2221837-2222019 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.17 Da        Isoelectric Point: 4.5331

>AT250384 WP_257803264.1 NZ_CP100291:2222046-2222441 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQQIDATARERKLSRSAFLALAAEHEMRAGA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References