Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 56697..57469 | Replicon | plasmid p48s3p |
Accession | NZ_CP100289 | ||
Organism | Burkholderia glumae strain BGR48S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NIX85_RS30025 | Protein ID | WP_257820497.1 |
Coordinates | 56697..57191 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | NIX85_RS30030 | Protein ID | WP_039204507.1 |
Coordinates | 57188..57469 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX85_RS30000 | 52900..53355 | + | 456 | WP_012732735.1 | transposase | - |
NIX85_RS30005 | 53355..53708 | + | 354 | WP_012732734.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NIX85_RS30010 | 53808..55394 | + | 1587 | WP_173941343.1 | IS66 family transposase | - |
NIX85_RS30015 | 55391..56044 | + | 654 | WP_257820570.1 | hypothetical protein | - |
NIX85_RS30020 | 56134..56604 | - | 471 | WP_080763678.1 | ProQ/FINO family protein | - |
NIX85_RS30025 | 56697..57191 | - | 495 | WP_257820497.1 | GNAT family N-acetyltransferase | Toxin |
NIX85_RS30030 | 57188..57469 | - | 282 | WP_039204507.1 | DUF1778 domain-containing protein | Antitoxin |
NIX85_RS30040 | 58544..59497 | - | 954 | WP_039205200.1 | hypothetical protein | - |
NIX85_RS30045 | 60113..60930 | + | 818 | WP_257758106.1 | IS5-like element ISBugl2 family transposase | - |
NIX85_RS30050 | 61055..62074 | + | 1020 | WP_252836473.1 | IS110 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..112798 | 112798 | |
- | flank | IS/Tn | - | - | 61055..62074 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17515.08 Da Isoelectric Point: 9.6522
>T250382 WP_257820497.1 NZ_CP100289:c57191-56697 [Burkholderia glumae]
MTGWRAPEPLSDAHGLDDFDSGVASLDKWLKRRALANQQSGASRTFVATRDGRVGAYYALASGVVTPEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGNGVGRALVRDAGLRVLHAAAAIGIRGLIVHALTDSAKAFYERVGFEASPIDPMLLLITLADL
EHAL
MTGWRAPEPLSDAHGLDDFDSGVASLDKWLKRRALANQQSGASRTFVATRDGRVGAYYALASGVVTPEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGNGVGRALVRDAGLRVLHAAAAIGIRGLIVHALTDSAKAFYERVGFEASPIDPMLLLITLADL
EHAL
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|