Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1093490..1094265 | Replicon | chromosome |
Accession | NZ_CP100286 | ||
Organism | Burkholderia glumae strain BGR48S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | C5AIF4 |
Locus tag | NIX85_RS21475 | Protein ID | WP_015877380.1 |
Coordinates | 1093768..1094265 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | C5AIF5 |
Locus tag | NIX85_RS21470 | Protein ID | WP_015877381.1 |
Coordinates | 1093490..1093771 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX85_RS21445 | 1089435..1090301 | - | 867 | WP_012732871.1 | IS21-like element ISBcen28 family helper ATPase IstB | - |
NIX85_RS21450 | 1090298..1091554 | - | 1257 | WP_257818908.1 | IS21 family transposase | - |
NIX85_RS21455 | 1091679..1092662 | + | 984 | Protein_933 | RHS repeat-associated core domain-containing protein | - |
NIX85_RS21460 | 1092671..1093033 | + | 363 | WP_017432434.1 | hypothetical protein | - |
NIX85_RS21465 | 1093116..1093493 | + | 378 | WP_173941242.1 | hypothetical protein | - |
NIX85_RS21470 | 1093490..1093771 | + | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
NIX85_RS21475 | 1093768..1094265 | + | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
NIX85_RS21480 | 1094346..1094843 | + | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
NIX85_RS21485 | 1095247..1096064 | + | 818 | WP_085962362.1 | IS5-like element ISBugl2 family transposase | - |
NIX85_RS21490 | 1096189..1097208 | + | 1020 | WP_252836473.1 | IS110 family transposase | - |
NIX85_RS21495 | 1098298..1099101 | + | 804 | WP_257819546.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1072169..1099101 | 26932 | |
- | inside | IScluster/Tn | - | - | 1089435..1097208 | 7773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250379 WP_015877380.1 NZ_CP100286:1093768-1094265 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC9 |