Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 6810..7347 | Replicon | plasmid pyh83p |
| Accession | NZ_CP100284 | ||
| Organism | Burkholderia glumae strain YH8 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | C5AN85 |
| Locus tag | NIY09_RS31375 | Protein ID | WP_012734112.1 |
| Coordinates | 7045..7347 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | C5AN86 |
| Locus tag | NIY09_RS31370 | Protein ID | WP_012734113.1 |
| Coordinates | 6810..7055 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY09_RS31345 | 2681..3262 | - | 582 | WP_257827588.1 | hypothetical protein | - |
| NIY09_RS31350 | 3306..3563 | - | 258 | WP_257827589.1 | ParB N-terminal domain-containing protein | - |
| NIY09_RS31735 | 4190..4411 | - | 222 | WP_276585563.1 | ParA family protein | - |
| NIY09_RS31360 | 5142..5870 | + | 729 | WP_012735342.1 | IS6 family transposase | - |
| NIY09_RS31365 | 6471..6656 | + | 186 | WP_148271081.1 | hypothetical protein | - |
| NIY09_RS31370 | 6810..7055 | + | 246 | WP_012734113.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| NIY09_RS31375 | 7045..7347 | + | 303 | WP_012734112.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NIY09_RS31380 | 7507..7749 | + | 243 | WP_043308436.1 | hypothetical protein | - |
| NIY09_RS31385 | 7957..8412 | + | 456 | WP_012734111.1 | hypothetical protein | - |
| NIY09_RS31390 | 8416..8697 | + | 282 | WP_043308454.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NIY09_RS31395 | 8881..9198 | + | 318 | WP_148271069.1 | hypothetical protein | - |
| NIY09_RS31400 | 9586..9870 | + | 285 | WP_017432347.1 | hypothetical protein | - |
| NIY09_RS31405 | 9884..10126 | + | 243 | WP_124837682.1 | hypothetical protein | - |
| NIY09_RS31410 | 10123..10368 | + | 246 | WP_127913916.1 | hypothetical protein | - |
| NIY09_RS31415 | 10425..10766 | + | 342 | WP_012732710.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..61432 | 61432 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11548.11 Da Isoelectric Point: 6.7171
>T250378 WP_012734112.1 NZ_CP100284:7045-7347 [Burkholderia glumae]
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|