Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 6810..7347 Replicon plasmid pyh83p
Accession NZ_CP100284
Organism Burkholderia glumae strain YH8

Toxin (Protein)


Gene name parE Uniprot ID C5AN85
Locus tag NIY09_RS31375 Protein ID WP_012734112.1
Coordinates 7045..7347 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID C5AN86
Locus tag NIY09_RS31370 Protein ID WP_012734113.1
Coordinates 6810..7055 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY09_RS31345 2681..3262 - 582 WP_257827588.1 hypothetical protein -
NIY09_RS31350 3306..3563 - 258 WP_257827589.1 ParB N-terminal domain-containing protein -
NIY09_RS31735 4190..4411 - 222 WP_276585563.1 ParA family protein -
NIY09_RS31360 5142..5870 + 729 WP_012735342.1 IS6 family transposase -
NIY09_RS31365 6471..6656 + 186 WP_148271081.1 hypothetical protein -
NIY09_RS31370 6810..7055 + 246 WP_012734113.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
NIY09_RS31375 7045..7347 + 303 WP_012734112.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIY09_RS31380 7507..7749 + 243 WP_043308436.1 hypothetical protein -
NIY09_RS31385 7957..8412 + 456 WP_012734111.1 hypothetical protein -
NIY09_RS31390 8416..8697 + 282 WP_043308454.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIY09_RS31395 8881..9198 + 318 WP_148271069.1 hypothetical protein -
NIY09_RS31400 9586..9870 + 285 WP_017432347.1 hypothetical protein -
NIY09_RS31405 9884..10126 + 243 WP_124837682.1 hypothetical protein -
NIY09_RS31410 10123..10368 + 246 WP_127913916.1 hypothetical protein -
NIY09_RS31415 10425..10766 + 342 WP_012732710.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..61432 61432


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-92)

Antitoxin

Antitoxin ParD

(1-80)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11548.11 Da        Isoelectric Point: 6.7171

>T250378 WP_012734112.1 NZ_CP100284:7045-7347 [Burkholderia glumae]
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY

Download         Length: 303 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8645.69 Da        Isoelectric Point: 7.2029

>AT250378 WP_012734113.1 NZ_CP100284:6810-7055 [Burkholderia glumae]
MPRNTSISLGDHLTQFVDTQVASGRYGSASDVVRAGLRLLETQETELKALKEALRASEASGAPAAFDGQAFLDRMRAKHA
G

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AN85

Antitoxin

Source ID Structure
AlphaFold DB C5AN86

References