Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2038646..2039321 | Replicon | chromosome |
| Accession | NZ_CP100281 | ||
| Organism | Burkholderia glumae strain YH8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIY09_RS25940 | Protein ID | WP_251119048.1 |
| Coordinates | 2038646..2038831 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIY09_RS25945 | Protein ID | WP_257806308.1 |
| Coordinates | 2038902..2039321 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY09_RS25900 | 2035110..2035565 | - | 456 | WP_251119056.1 | hypothetical protein | - |
| NIY09_RS25905 | 2035562..2036125 | - | 564 | WP_257827474.1 | hypothetical protein | - |
| NIY09_RS25910 | 2036134..2036796 | - | 663 | WP_257827475.1 | KilA-N domain-containing protein | - |
| NIY09_RS25915 | 2036789..2037067 | - | 279 | WP_257757928.1 | hypothetical protein | - |
| NIY09_RS25920 | 2037060..2037338 | - | 279 | WP_257757926.1 | hypothetical protein | - |
| NIY09_RS25925 | 2037331..2037648 | - | 318 | WP_257827478.1 | hypothetical protein | - |
| NIY09_RS25930 | 2037669..2037854 | - | 186 | WP_257757923.1 | Arc family DNA-binding protein | - |
| NIY09_RS25935 | 2037948..2038481 | + | 534 | WP_257827480.1 | helix-turn-helix transcriptional regulator | - |
| NIY09_RS25940 | 2038646..2038831 | + | 186 | WP_251119048.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIY09_RS25945 | 2038902..2039321 | + | 420 | WP_257806308.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIY09_RS25950 | 2039462..2040238 | + | 777 | WP_257827482.1 | SGNH/GDSL hydrolase family protein | - |
| NIY09_RS25955 | 2040238..2041347 | + | 1110 | WP_257827483.1 | acyltransferase | - |
| NIY09_RS25960 | 2041422..2043572 | - | 2151 | WP_257827485.1 | hypothetical protein | - |
| NIY09_RS25965 | 2043569..2043898 | - | 330 | WP_257827486.1 | hypothetical protein | - |
| NIY09_RS25970 | 2043908..2044126 | - | 219 | WP_251119041.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2018503..2090512 | 72009 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6934.04 Da Isoelectric Point: 10.7447
>T250375 WP_251119048.1 NZ_CP100281:2038646-2038831 [Burkholderia glumae]
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15070.56 Da Isoelectric Point: 5.2435
>AT250375 WP_257806308.1 NZ_CP100281:2038902-2039321 [Burkholderia glumae]
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAEPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAEPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|