Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1714613..1715388 | Replicon | chromosome |
Accession | NZ_CP100281 | ||
Organism | Burkholderia glumae strain YH8 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | C5AIF4 |
Locus tag | NIY09_RS24480 | Protein ID | WP_015877380.1 |
Coordinates | 1714613..1715110 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | C5AIF5 |
Locus tag | NIY09_RS24485 | Protein ID | WP_015877381.1 |
Coordinates | 1715107..1715388 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY09_RS24445 | 1709665..1709976 | - | 312 | WP_015877377.1 | hypothetical protein | - |
NIY09_RS24450 | 1709993..1710244 | - | 252 | WP_230674552.1 | hypothetical protein | - |
NIY09_RS24455 | 1710371..1710976 | - | 606 | Protein_1346 | RHS repeat-associated core domain-containing protein | - |
NIY09_RS24460 | 1711390..1711563 | - | 174 | WP_257806536.1 | ProQ/FinO family protein | - |
NIY09_RS24465 | 1711679..1713265 | - | 1587 | WP_012732733.1 | IS66 family transposase | - |
NIY09_RS24470 | 1713365..1713718 | - | 354 | WP_012732734.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NIY09_RS24475 | 1713718..1714173 | - | 456 | WP_012732735.1 | transposase | - |
NIY09_RS24480 | 1714613..1715110 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
NIY09_RS24485 | 1715107..1715388 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
NIY09_RS24490 | 1715385..1715762 | - | 378 | WP_173941242.1 | hypothetical protein | - |
NIY09_RS24495 | 1715845..1716207 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fliC | 1695477..1743635 | 48158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250374 WP_015877380.1 NZ_CP100281:c1715110-1714613 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC9 |