Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2294106..2294710 | Replicon | chromosome |
Accession | NZ_CP100280 | ||
Organism | Burkholderia glumae strain YH8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NIY09_RS10910 | Protein ID | WP_017922254.1 |
Coordinates | 2294106..2294288 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NIY09_RS10915 | Protein ID | WP_257827237.1 |
Coordinates | 2294315..2294710 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY09_RS10885 | 2289590..2289838 | - | 249 | WP_039201402.1 | gpW family head-tail joining protein | - |
NIY09_RS10890 | 2289855..2291927 | - | 2073 | WP_257827235.1 | phage terminase large subunit family protein | - |
NIY09_RS10895 | 2291980..2292684 | - | 705 | WP_039201372.1 | hypothetical protein | - |
NIY09_RS10900 | 2292967..2293329 | - | 363 | WP_039201376.1 | DUF2591 family protein | - |
NIY09_RS10905 | 2293335..2293955 | - | 621 | WP_039201377.1 | hypothetical protein | - |
NIY09_RS10910 | 2294106..2294288 | + | 183 | WP_017922254.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NIY09_RS10915 | 2294315..2294710 | + | 396 | WP_257827237.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NIY09_RS10920 | 2295152..2295385 | + | 234 | WP_257803289.1 | hypothetical protein | - |
NIY09_RS10925 | 2296471..2296902 | - | 432 | WP_039201379.1 | hypothetical protein | - |
NIY09_RS10930 | 2296895..2297488 | - | 594 | WP_257827239.1 | hypothetical protein | - |
NIY09_RS10935 | 2297472..2297690 | - | 219 | WP_017922250.1 | hypothetical protein | - |
NIY09_RS10940 | 2297737..2298246 | - | 510 | WP_257744542.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2262725..2310829 | 48104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6599.76 Da Isoelectric Point: 11.2641
>T250373 WP_017922254.1 NZ_CP100280:2294106-2294288 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14436.22 Da Isoelectric Point: 4.6421
>AT250373 WP_257827237.1 NZ_CP100280:2294315-2294710 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPVPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPVPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|