Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1694033..1694808 | Replicon | chromosome |
Accession | NZ_CP100275 | ||
Organism | Burkholderia glumae strain BGR73S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | C5AIF4 |
Locus tag | NIY00_RS25430 | Protein ID | WP_015877380.1 |
Coordinates | 1694033..1694530 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | C5AIF5 |
Locus tag | NIY00_RS25435 | Protein ID | WP_015877381.1 |
Coordinates | 1694527..1694808 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY00_RS25395 | 1690054..1690149 | - | 96 | Protein_1328 | IS5/IS1182 family transposase | - |
NIY00_RS25400 | 1690221..1690766 | - | 546 | Protein_1329 | IS3 family transposase | - |
NIY00_RS25405 | 1690959..1691764 | + | 806 | WP_085962370.1 | IS5 family transposase | - |
NIY00_RS25410 | 1691730..1692041 | - | 312 | WP_015877377.1 | hypothetical protein | - |
NIY00_RS25415 | 1692058..1692360 | - | 303 | WP_255220127.1 | DUF2380 domain-containing protein | - |
NIY00_RS25420 | 1692436..1693041 | - | 606 | Protein_1333 | RHS repeat-associated core domain-containing protein | - |
NIY00_RS25425 | 1693455..1693952 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
NIY00_RS25430 | 1694033..1694530 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
NIY00_RS25435 | 1694527..1694808 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
NIY00_RS25440 | 1694805..1695182 | - | 378 | WP_173941242.1 | hypothetical protein | - |
NIY00_RS25445 | 1695265..1695627 | - | 363 | WP_017432434.1 | hypothetical protein | - |
NIY00_RS25450 | 1695636..1699763 | - | 4128 | WP_275995111.1 | RHS repeat-associated core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250369 WP_015877380.1 NZ_CP100275:c1694530-1694033 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC9 |