Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 30261..30798 Replicon plasmid p79s4p
Accession NZ_CP100267
Organism Burkholderia glumae strain BGR79S

Toxin (Protein)


Gene name parE Uniprot ID C5AN85
Locus tag NIX86_RS31355 Protein ID WP_012734112.1
Coordinates 30261..30563 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID C5AN86
Locus tag NIX86_RS31360 Protein ID WP_012734113.1
Coordinates 30553..30798 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX86_RS31315 26842..27183 - 342 WP_012732710.1 hypothetical protein -
NIX86_RS31320 27240..27485 - 246 WP_127913916.1 hypothetical protein -
NIX86_RS31325 27482..27724 - 243 WP_124837682.1 hypothetical protein -
NIX86_RS31330 27738..28022 - 285 WP_017432347.1 hypothetical protein -
NIX86_RS31335 28410..28727 - 318 WP_148271069.1 hypothetical protein -
NIX86_RS31340 28911..29192 - 282 WP_043308454.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIX86_RS31345 29196..29651 - 456 WP_012734111.1 hypothetical protein -
NIX86_RS31350 29859..30101 - 243 WP_043308436.1 hypothetical protein -
NIX86_RS31355 30261..30563 - 303 WP_012734112.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NIX86_RS31360 30553..30798 - 246 WP_012734113.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
NIX86_RS31365 30952..31137 - 186 WP_257814238.1 hypothetical protein -
NIX86_RS31370 31692..32036 - 345 WP_251107960.1 hypothetical protein -
NIX86_RS31375 32155..32538 - 384 WP_251107961.1 hypothetical protein -
NIX86_RS31380 32538..32759 - 222 WP_251107962.1 ribbon-helix-helix domain-containing protein -
NIX86_RS31385 33536..34180 + 645 WP_251107963.1 division plane positioning ATPase MipZ -
NIX86_RS31390 34347..34505 + 159 WP_257744776.1 plasmid partition protein ParG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..80567 80567


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-92)

Antitoxin

Antitoxin ParD

(1-80)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11548.11 Da        Isoelectric Point: 6.7171

>T250364 WP_012734112.1 NZ_CP100267:c30563-30261 [Burkholderia glumae]
MRGKARVVRLTPLAEADLEDIWAYIFEQWSLAQAEQYVGEIVAAFNRLARGEWVGAVRGEPYRRYLVGFHAVFYRETTDA
LDVACVRHQRMDVGSHLSQY

Download         Length: 303 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8645.69 Da        Isoelectric Point: 7.2029

>AT250364 WP_012734113.1 NZ_CP100267:c30798-30553 [Burkholderia glumae]
MPRNTSISLGDHLTQFVDTQVASGRYGSASDVVRAGLRLLETQETELKALKEALRASEASGAPAAFDGQAFLDRMRAKHA
G

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AN85

Antitoxin

Source ID Structure
AlphaFold DB C5AN86

References