Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 184413..185008 | Replicon | plasmid p79s1p |
Accession | NZ_CP100264 | ||
Organism | Burkholderia glumae strain BGR79S |
Toxin (Protein)
Gene name | chpB | Uniprot ID | C5AN78 |
Locus tag | NIX86_RS30020 | Protein ID | WP_012734107.1 |
Coordinates | 184413..184763 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | C5AN79 |
Locus tag | NIX86_RS30025 | Protein ID | WP_012734108.1 |
Coordinates | 184757..185008 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX86_RS29995 | 179635..180381 | - | 747 | WP_232252306.1 | energy transducer TonB | - |
NIX86_RS30000 | 180413..182788 | - | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
NIX86_RS30005 | 183102..183566 | - | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
NIX86_RS30010 | 183789..184010 | - | 222 | WP_017433768.1 | hypothetical protein | - |
NIX86_RS30015 | 184160..184354 | - | 195 | WP_124837685.1 | hypothetical protein | - |
NIX86_RS30020 | 184413..184763 | - | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
NIX86_RS30025 | 184757..185008 | - | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NIX86_RS30030 | 185271..185678 | - | 408 | WP_230674618.1 | hypothetical protein | - |
NIX86_RS30035 | 185781..187616 | - | 1836 | WP_124837684.1 | site-specific integrase | - |
NIX86_RS30040 | 187619..187960 | - | 342 | WP_012732710.1 | hypothetical protein | - |
NIX86_RS30045 | 188017..188262 | - | 246 | WP_127913916.1 | hypothetical protein | - |
NIX86_RS30050 | 188259..188501 | - | 243 | WP_124837682.1 | hypothetical protein | - |
NIX86_RS30055 | 188515..188799 | - | 285 | WP_017432347.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..189346 | 189346 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250363 WP_012734107.1 NZ_CP100264:c184763-184413 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MF70 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MFN5 |