Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2277960..2278564 | Replicon | chromosome |
| Accession | NZ_CP100262 | ||
| Organism | Burkholderia glumae strain BGR79S | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIX86_RS10725 | Protein ID | WP_017922254.1 |
| Coordinates | 2277960..2278142 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIX86_RS10730 | Protein ID | WP_017922253.1 |
| Coordinates | 2278169..2278564 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX86_RS10695 | 2273445..2273693 | - | 249 | WP_039201402.1 | gpW family head-tail joining protein | - |
| NIX86_RS10700 | 2273710..2275782 | - | 2073 | WP_230674381.1 | phage terminase large subunit family protein | - |
| NIX86_RS10705 | 2275835..2276539 | - | 705 | WP_039201372.1 | hypothetical protein | - |
| NIX86_RS10710 | 2276589..2276834 | - | 246 | WP_039201374.1 | hypothetical protein | - |
| NIX86_RS10715 | 2276821..2277183 | - | 363 | WP_039201376.1 | DUF2591 family protein | - |
| NIX86_RS10720 | 2277189..2277809 | - | 621 | WP_039201377.1 | hypothetical protein | - |
| NIX86_RS10725 | 2277960..2278142 | + | 183 | WP_017922254.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIX86_RS10730 | 2278169..2278564 | + | 396 | WP_017922253.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIX86_RS10735 | 2278861..2279292 | - | 432 | WP_039201379.1 | hypothetical protein | - |
| NIX86_RS10740 | 2279285..2279878 | - | 594 | WP_039201381.1 | hypothetical protein | - |
| NIX86_RS10745 | 2279862..2280080 | - | 219 | WP_017922250.1 | hypothetical protein | - |
| NIX86_RS10750 | 2280116..2280637 | - | 522 | WP_257812854.1 | hypothetical protein | - |
| NIX86_RS10755 | 2280657..2282399 | - | 1743 | WP_052231208.1 | toprim domain-containing protein | - |
| NIX86_RS10760 | 2282396..2283346 | - | 951 | WP_155296968.1 | helix-turn-helix domain-containing protein | - |
| NIX86_RS10765 | 2283346..2283561 | - | 216 | WP_155296969.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2240916..2293398 | 52482 | |
| - | inside | Prophage | - | - | 2243472..2293398 | 49926 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6599.76 Da Isoelectric Point: 11.2641
>T250362 WP_017922254.1 NZ_CP100262:2277960-2278142 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14466.21 Da Isoelectric Point: 4.5532
>AT250362 WP_017922253.1 NZ_CP100262:2278169-2278564 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|