Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 165563..166140 | Replicon | plasmid p76s2p |
| Accession | NZ_CP100259 | ||
| Organism | Burkholderia glumae strain BGR76S | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NIX80_RS31320 | Protein ID | WP_186012873.1 |
| Coordinates | 165563..165928 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NIX80_RS31325 | Protein ID | WP_098183406.1 |
| Coordinates | 165922..166140 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX80_RS31290 | 160612..161604 | + | 993 | WP_257806835.1 | IS5 family transposase | - |
| NIX80_RS31295 | 161826..162818 | + | 993 | WP_257806835.1 | IS5 family transposase | - |
| NIX80_RS31300 | 163012..163769 | + | 758 | Protein_136 | IS5 family transposase | - |
| NIX80_RS31305 | 163777..164004 | - | 228 | WP_257806837.1 | hypothetical protein | - |
| NIX80_RS31310 | 164069..164755 | - | 687 | WP_257806838.1 | hypothetical protein | - |
| NIX80_RS31315 | 164776..165303 | - | 528 | WP_257806839.1 | hypothetical protein | - |
| NIX80_RS31320 | 165563..165928 | - | 366 | WP_186012873.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIX80_RS31325 | 165922..166140 | - | 219 | WP_098183406.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| NIX80_RS31330 | 166288..166722 | - | 435 | WP_257806909.1 | tyrosine-type recombinase/integrase | - |
| NIX80_RS31335 | 166989..167981 | - | 993 | WP_257806835.1 | IS5 family transposase | - |
| NIX80_RS31340 | 168089..168886 | - | 798 | WP_257806840.1 | IS5 family transposase | - |
| NIX80_RS31345 | 169020..170012 | + | 993 | WP_257806835.1 | IS5 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..177259 | 177259 | |
| - | inside | IScluster/Tn | - | - | 158561..170012 | 11451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13386.51 Da Isoelectric Point: 7.0133
>T250360 WP_186012873.1 NZ_CP100259:c165928-165563 [Burkholderia glumae]
MVKALFDTNILIDYLNGVGAAKKELARYEYRAISVITWMEVLVGASGEEDAAIRAWLDTFDVVAVDSAIANRAVEIRKAK
KIRLPDAIVWASAQVHSVLLVSRNTKDFPADEPGVRVPYKI
MVKALFDTNILIDYLNGVGAAKKELARYEYRAISVITWMEVLVGASGEEDAAIRAWLDTFDVVAVDSAIANRAVEIRKAK
KIRLPDAIVWASAQVHSVLLVSRNTKDFPADEPGVRVPYKI
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|