Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 128356..129005 Replicon plasmid p76s1p
Accession NZ_CP100258
Organism Burkholderia glumae strain BGR76S

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NIX80_RS29430 Protein ID WP_257806654.1
Coordinates 128356..128766 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NIX80_RS29435 Protein ID WP_257806656.1
Coordinates 128763..129005 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX80_RS29390 123397..125223 - 1827 WP_012735349.1 site-specific integrase -
NIX80_RS29395 125220..125600 - 381 WP_080569442.1 hypothetical protein -
NIX80_RS29400 125603..125920 - 318 WP_050811486.1 hypothetical protein -
NIX80_RS29405 125971..127059 - 1089 Protein_115 hypothetical protein -
NIX80_RS29410 127070..127333 - 264 WP_148271091.1 hypothetical protein -
NIX80_RS29415 127383..127616 - 234 WP_043308726.1 hypothetical protein -
NIX80_RS29420 127623..127919 - 297 WP_043308728.1 hypothetical protein -
NIX80_RS29425 128084..128284 - 201 WP_257806653.1 hypothetical protein -
NIX80_RS29430 128356..128766 - 411 WP_257806654.1 type II toxin-antitoxin system VapC family toxin Toxin
NIX80_RS29435 128763..129005 - 243 WP_257806656.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIX80_RS29440 129424..129759 + 336 WP_252836630.1 metalloregulator ArsR/SmtB family transcription factor -
NIX80_RS29445 129756..130234 + 479 Protein_123 ArsI/CadI family heavy metal resistance metalloenzyme -
NIX80_RS29450 130244..130738 + 495 WP_252836631.1 arsenate reductase ArsC -
NIX80_RS29455 130755..131249 + 495 WP_252836632.1 arsenate reductase ArsC -
NIX80_RS29460 131314..132387 + 1074 WP_252836633.1 ACR3 family arsenite efflux transporter -
NIX80_RS29465 132389..133627 + 1239 WP_252836634.1 MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..362586 362586


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(12-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14762.07 Da        Isoelectric Point: 5.6956

>T250358 WP_257806654.1 NZ_CP100258:c128766-128356 [Burkholderia glumae]
MTLYLLDTNILSSVIRDPRGACATRIGHTQPEQICTSIIVAAELRFGVFKRGSPTLAQRVEQLLASLSVLPLQPDADQCY
GRLRADLEKQGQLIGANDMLIAAHALALEAVLVTDNTAEFARVAGLPVENWLRPTP

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9195.39 Da        Isoelectric Point: 4.6234

>AT250358 WP_257806656.1 NZ_CP100258:c129005-128763 [Burkholderia glumae]
MPAHDTRHARLFRNGRSQAVRIPREFELSASEVTIYREGARLIIEPVQAAPLRELFAQWTPLDETFPDIENLPAEPVDIE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References