Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
Location | 121647..122284 | Replicon | plasmid p76s1p |
Accession | NZ_CP100258 | ||
Organism | Burkholderia glumae strain BGR76S |
Toxin (Protein)
Gene name | vapC | Uniprot ID | C5AP38 |
Locus tag | NIX80_RS29375 | Protein ID | WP_012735347.1 |
Coordinates | 121647..122048 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | C5AP39 |
Locus tag | NIX80_RS29380 | Protein ID | WP_012735348.1 |
Coordinates | 122048..122284 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX80_RS29345 | 118110..118379 | + | 270 | WP_012735343.1 | hypothetical protein | - |
NIX80_RS29350 | 118539..119153 | + | 615 | Protein_104 | error-prone DNA polymerase | - |
NIX80_RS29355 | 119169..119456 | + | 288 | WP_012735344.1 | hypothetical protein | - |
NIX80_RS29360 | 120560..120754 | - | 195 | WP_124837731.1 | hypothetical protein | - |
NIX80_RS29365 | 120809..121051 | - | 243 | WP_012735345.1 | hypothetical protein | - |
NIX80_RS29370 | 121069..121632 | - | 564 | WP_012735346.1 | hypothetical protein | - |
NIX80_RS29375 | 121647..122048 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIX80_RS29380 | 122048..122284 | - | 237 | WP_012735348.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NIX80_RS29385 | 122621..123313 | - | 693 | WP_043308722.1 | hypothetical protein | - |
NIX80_RS29390 | 123397..125223 | - | 1827 | WP_012735349.1 | site-specific integrase | - |
NIX80_RS29395 | 125220..125600 | - | 381 | WP_080569442.1 | hypothetical protein | - |
NIX80_RS29400 | 125603..125920 | - | 318 | WP_050811486.1 | hypothetical protein | - |
NIX80_RS29405 | 125971..127059 | - | 1089 | Protein_115 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..362586 | 362586 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T250357 WP_012735347.1 NZ_CP100258:c122048-121647 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|