Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2033777..2034452 | Replicon | chromosome |
| Accession | NZ_CP100257 | ||
| Organism | Burkholderia glumae strain BGR76S | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIX80_RS24885 | Protein ID | WP_251119048.1 |
| Coordinates | 2033777..2033962 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIX80_RS24890 | Protein ID | WP_257806308.1 |
| Coordinates | 2034033..2034452 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX80_RS24835 | 2028968..2029195 | - | 228 | WP_257806294.1 | hypothetical protein | - |
| NIX80_RS24840 | 2029503..2029958 | - | 456 | WP_251119056.1 | hypothetical protein | - |
| NIX80_RS24845 | 2029955..2030524 | - | 570 | WP_257806295.1 | hypothetical protein | - |
| NIX80_RS24850 | 2030527..2031189 | - | 663 | WP_257806296.1 | KilA-N domain-containing protein | - |
| NIX80_RS24855 | 2031189..2031410 | - | 222 | WP_257806297.1 | hypothetical protein | - |
| NIX80_RS24860 | 2031403..2031681 | - | 279 | WP_257806298.1 | hypothetical protein | - |
| NIX80_RS24865 | 2031674..2031991 | - | 318 | WP_257806299.1 | hypothetical protein | - |
| NIX80_RS24870 | 2032073..2032258 | - | 186 | WP_257806301.1 | hypothetical protein | - |
| NIX80_RS24875 | 2032255..2033025 | - | 771 | WP_257806303.1 | KilA-N domain-containing protein | - |
| NIX80_RS24880 | 2033143..2033601 | + | 459 | WP_257806304.1 | Arc family DNA-binding protein | - |
| NIX80_RS24885 | 2033777..2033962 | + | 186 | WP_251119048.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIX80_RS24890 | 2034033..2034452 | + | 420 | WP_257806308.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIX80_RS24895 | 2034593..2035369 | + | 777 | WP_257806311.1 | SGNH/GDSL hydrolase family protein | - |
| NIX80_RS24900 | 2035372..2036448 | + | 1077 | WP_257806313.1 | acyltransferase | - |
| NIX80_RS24905 | 2036450..2038582 | - | 2133 | WP_257806316.1 | hypothetical protein | - |
| NIX80_RS24910 | 2038579..2038908 | - | 330 | WP_257806319.1 | hypothetical protein | - |
| NIX80_RS24915 | 2038918..2039136 | - | 219 | WP_251119041.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2015616..2085035 | 69419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6934.04 Da Isoelectric Point: 10.7447
>T250356 WP_251119048.1 NZ_CP100257:2033777-2033962 [Burkholderia glumae]
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15070.56 Da Isoelectric Point: 5.2435
>AT250356 WP_257806308.1 NZ_CP100257:2034033-2034452 [Burkholderia glumae]
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAEPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAEPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|