Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1710343..1711118 | Replicon | chromosome |
| Accession | NZ_CP100257 | ||
| Organism | Burkholderia glumae strain BGR76S | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | C5AIF4 |
| Locus tag | NIX80_RS23425 | Protein ID | WP_015877380.1 |
| Coordinates | 1710343..1710840 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | C5AIF5 |
| Locus tag | NIX80_RS23430 | Protein ID | WP_015877381.1 |
| Coordinates | 1710837..1711118 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX80_RS23390 | 1705395..1705706 | - | 312 | WP_015877377.1 | hypothetical protein | - |
| NIX80_RS23395 | 1705723..1705974 | - | 252 | WP_230674552.1 | hypothetical protein | - |
| NIX80_RS23400 | 1706101..1706706 | - | 606 | Protein_1350 | RHS repeat-associated core domain-containing protein | - |
| NIX80_RS23405 | 1707120..1707293 | - | 174 | WP_257806536.1 | ProQ/FinO family protein | - |
| NIX80_RS23410 | 1707409..1708995 | - | 1587 | WP_012732733.1 | IS66 family transposase | - |
| NIX80_RS23415 | 1709095..1709448 | - | 354 | WP_012732734.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NIX80_RS23420 | 1709448..1709903 | - | 456 | WP_012732735.1 | transposase | - |
| NIX80_RS23425 | 1710343..1710840 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
| NIX80_RS23430 | 1710837..1711118 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
| NIX80_RS23435 | 1711115..1711492 | - | 378 | WP_173941242.1 | hypothetical protein | - |
| NIX80_RS23440 | 1711575..1711937 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fliC | 1691207..1739365 | 48158 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250355 WP_015877380.1 NZ_CP100257:c1710840-1710343 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC9 |