Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-ChpS
Location 11252..11847 Replicon plasmid p35s3p
Accession NZ_CP100254
Organism Burkholderia glumae strain BGR35S

Toxin (Protein)


Gene name chpB Uniprot ID C5AN78
Locus tag NIX82_RS31195 Protein ID WP_012734107.1
Coordinates 11497..11847 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID C5AN79
Locus tag NIX82_RS31190 Protein ID WP_012734108.1
Coordinates 11252..11503 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX82_RS31155 6521..6709 + 189 WP_017432455.1 hypothetical protein -
NIX82_RS31160 7461..7745 + 285 WP_017432347.1 hypothetical protein -
NIX82_RS31165 7759..8001 + 243 WP_124837682.1 hypothetical protein -
NIX82_RS31170 7998..8243 + 246 WP_127913916.1 hypothetical protein -
NIX82_RS31175 8300..8641 + 342 WP_012732710.1 hypothetical protein -
NIX82_RS31180 8644..10479 + 1836 WP_124837684.1 site-specific integrase -
NIX82_RS31185 10582..10989 + 408 WP_257829860.1 hypothetical protein -
NIX82_RS31190 11252..11503 + 252 WP_012734108.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIX82_RS31195 11497..11847 + 351 WP_012734107.1 type II toxin-antitoxin system ChpB family toxin Toxin
NIX82_RS31200 11906..12100 + 195 WP_124837685.1 hypothetical protein -
NIX82_RS31205 12250..12471 + 222 WP_017433768.1 hypothetical protein -
NIX82_RS31210 12694..13158 + 465 WP_012734106.1 Lrp/AsnC family transcriptional regulator -
NIX82_RS31215 13472..14860 + 1389 WP_257829973.1 TonB-dependent receptor -
NIX82_RS31220 14743..15480 + 738 WP_257829974.1 TonB-dependent receptor -
NIX82_RS31225 15462..15845 + 384 WP_257829987.1 TonB-dependent receptor -
NIX82_RS31230 16038..16223 - 186 WP_254226663.1 hypothetical protein -
NIX82_RS31235 16251..16622 + 372 WP_257829975.1 energy transducer TonB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..139253 139253


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(8-114)

Antitoxin

Antitoxin PemI-like

(1-83)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12389.37 Da        Isoelectric Point: 8.8909

>T250354 WP_012734107.1 NZ_CP100254:11497-11847 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 8940.31 Da        Isoelectric Point: 6.2420

>AT250354 WP_012734108.1 NZ_CP100254:11252-11503 [Burkholderia glumae]
MELKIQKWGNSAAVRLPSVLLEQINASVGGSLNADVRPDGVLLTPARRKYALDDLVAQCDTKAPVPADMAAWGEIKPVGR
EAW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246MF70

Antitoxin

Source ID Structure
AlphaFold DB A0A246MFN5

References