Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 36840..37417 | Replicon | plasmid p35s2p |
Accession | NZ_CP100253 | ||
Organism | Burkholderia glumae strain BGR35S |
Toxin (Protein)
Gene name | vapC | Uniprot ID | F2LRT1 |
Locus tag | NIX82_RS30345 | Protein ID | WP_013699949.1 |
Coordinates | 37052..37417 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | F2LRT2 |
Locus tag | NIX82_RS30340 | Protein ID | WP_013699950.1 |
Coordinates | 36840..37058 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX82_RS30320 | 32249..32602 | + | 354 | WP_012732734.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NIX82_RS30325 | 32702..34288 | + | 1587 | WP_012732733.1 | IS66 family transposase | - |
NIX82_RS30330 | 34592..35632 | + | 1041 | WP_257829937.1 | hypothetical protein | - |
NIX82_RS30335 | 35676..36374 | - | 699 | WP_257829938.1 | hypothetical protein | - |
NIX82_RS30340 | 36840..37058 | + | 219 | WP_013699950.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
NIX82_RS30345 | 37052..37417 | + | 366 | WP_013699949.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIX82_RS30350 | 37461..37643 | + | 183 | WP_148270663.1 | hypothetical protein | - |
NIX82_RS30355 | 37710..37955 | + | 246 | WP_257829939.1 | hypothetical protein | - |
NIX82_RS30360 | 38371..39417 | + | 1047 | WP_257829940.1 | IS481 family transposase | - |
NIX82_RS30365 | 39447..39572 | - | 126 | WP_257829942.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..172021 | 172021 | |
- | inside | IScluster/Tn | - | - | 32249..39417 | 7168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13467.63 Da Isoelectric Point: 8.4446
>T250353 WP_013699949.1 NZ_CP100253:37052-37417 [Burkholderia glumae]
MVKALFDTNILIDYLGGIAAAKKELGRYEYRAISTITWMEVLVGASSGEEDAIRGWLDSFDVIPVGSDIANRAVVIRKAR
RIRLPDAIIWATAQVHSLLLVSRNTKDFPPDEPGVRIPYKL
MVKALFDTNILIDYLGGIAAAKKELGRYEYRAISTITWMEVLVGASSGEEDAIRGWLDSFDVIPVGSDIANRAVVIRKAR
RIRLPDAIIWATAQVHSLLLVSRNTKDFPPDEPGVRIPYKL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|