Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-ChpS
Location 128757..129352 Replicon plasmid p28s2p
Accession NZ_CP100247
Organism Burkholderia glumae strain BGR28S

Toxin (Protein)


Gene name chpB Uniprot ID C5AN78
Locus tag NIX71_RS30920 Protein ID WP_012734107.1
Coordinates 128757..129107 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID C5AN79
Locus tag NIX71_RS30925 Protein ID WP_012734108.1
Coordinates 129101..129352 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX71_RS30895 123979..124725 - 747 WP_232252306.1 energy transducer TonB -
NIX71_RS30900 124757..127132 - 2376 WP_232252305.1 TonB-dependent receptor -
NIX71_RS30905 127446..127910 - 465 WP_012734106.1 Lrp/AsnC family transcriptional regulator -
NIX71_RS30910 128133..128354 - 222 WP_017433768.1 hypothetical protein -
NIX71_RS30915 128504..128698 - 195 WP_124837685.1 hypothetical protein -
NIX71_RS30920 128757..129107 - 351 WP_012734107.1 type II toxin-antitoxin system ChpB family toxin Toxin
NIX71_RS30925 129101..129352 - 252 WP_012734108.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIX71_RS30930 129615..130022 - 408 WP_230674618.1 hypothetical protein -
NIX71_RS30935 130125..131960 - 1836 WP_012732711.1 site-specific integrase -
NIX71_RS30940 131963..132304 - 342 WP_012732710.1 hypothetical protein -
NIX71_RS30945 132361..132606 - 246 WP_127913916.1 hypothetical protein -
NIX71_RS30950 132603..132845 - 243 WP_124837682.1 hypothetical protein -
NIX71_RS30955 132859..133143 - 285 WP_257825046.1 hypothetical protein -
NIX71_RS30960 133531..133848 - 318 WP_148271069.1 hypothetical protein -
NIX71_RS30965 134032..134313 - 282 WP_043308454.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..136971 136971


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(8-114)

Antitoxin

Antitoxin PemI-like

(1-83)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12389.37 Da        Isoelectric Point: 8.8909

>T250350 WP_012734107.1 NZ_CP100247:c129107-128757 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 8940.31 Da        Isoelectric Point: 6.2420

>AT250350 WP_012734108.1 NZ_CP100247:c129352-129101 [Burkholderia glumae]
MELKIQKWGNSAAVRLPSVLLEQINASVGGSLNADVRPDGVLLTPARRKYALDDLVAQCDTKAPVPADMAAWGEIKPVGR
EAW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246MF70

Antitoxin

Source ID Structure
AlphaFold DB A0A246MFN5

References