Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 160156..160793 Replicon plasmid p28s1p
Accession NZ_CP100246
Organism Burkholderia glumae strain BGR28S

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIX71_RS30170 Protein ID WP_012735347.1
Coordinates 160156..160557 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIX71_RS30175 Protein ID WP_012735348.1
Coordinates 160557..160793 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX71_RS30140 156619..156888 + 270 WP_012735343.1 hypothetical protein -
NIX71_RS30145 157048..157662 + 615 Protein_150 error-prone DNA polymerase -
NIX71_RS30150 157678..157965 + 288 WP_012735344.1 hypothetical protein -
NIX71_RS30155 159069..159263 - 195 WP_124837731.1 hypothetical protein -
NIX71_RS30160 159318..159560 - 243 WP_012735345.1 hypothetical protein -
NIX71_RS30165 159578..160141 - 564 WP_012735346.1 hypothetical protein -
NIX71_RS30170 160156..160557 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIX71_RS30175 160557..160793 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIX71_RS30180 161130..161822 - 693 WP_043308722.1 hypothetical protein -
NIX71_RS30185 161906..163732 - 1827 WP_012735349.1 site-specific integrase -
NIX71_RS30190 163729..164109 - 381 WP_080569442.1 hypothetical protein -
NIX71_RS30195 164112..164429 - 318 WP_050811486.1 hypothetical protein -
NIX71_RS30200 164480..165568 - 1089 Protein_161 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..169201 169201


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250349 WP_012735347.1 NZ_CP100246:c160557-160156 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250349 WP_012735348.1 NZ_CP100246:c160793-160557 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References