Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1663754..1664529 | Replicon | chromosome |
| Accession | NZ_CP100245 | ||
| Organism | Burkholderia glumae strain BGR28S | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | C5AIF4 |
| Locus tag | NIX71_RS24335 | Protein ID | WP_015877380.1 |
| Coordinates | 1663754..1664251 (-) | Length | 166 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | C5AIF5 |
| Locus tag | NIX71_RS24340 | Protein ID | WP_015877381.1 |
| Coordinates | 1664248..1664529 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX71_RS24300 | 1659775..1659870 | - | 96 | Protein_1306 | IS5/IS1182 family transposase | - |
| NIX71_RS24305 | 1659942..1660487 | - | 546 | Protein_1307 | IS3 family transposase | - |
| NIX71_RS24310 | 1660680..1661485 | + | 806 | WP_085962370.1 | IS5 family transposase | - |
| NIX71_RS24315 | 1661451..1661762 | - | 312 | WP_015877377.1 | hypothetical protein | - |
| NIX71_RS24320 | 1661779..1662030 | - | 252 | WP_230674552.1 | hypothetical protein | - |
| NIX71_RS24325 | 1662157..1662762 | - | 606 | Protein_1311 | RHS repeat-associated core domain-containing protein | - |
| NIX71_RS24330 | 1663176..1663673 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
| NIX71_RS24335 | 1663754..1664251 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
| NIX71_RS24340 | 1664248..1664529 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
| NIX71_RS24345 | 1664526..1664903 | - | 378 | WP_173941242.1 | hypothetical protein | - |
| NIX71_RS24350 | 1664986..1665348 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fliC | 1647761..1690077 | 42316 | |
| - | flank | IS/Tn | - | - | 1659918..1660460 | 542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250347 WP_015877380.1 NZ_CP100245:c1664251-1663754 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J9HNC9 |