Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2971952..2972556 Replicon chromosome
Accession NZ_CP100244
Organism Burkholderia glumae strain BGR28S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIX71_RS14025 Protein ID WP_017922254.1
Coordinates 2971952..2972134 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIX71_RS14030 Protein ID WP_017922253.1
Coordinates 2972161..2972556 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX71_RS13995 2967437..2967685 - 249 WP_039201402.1 gpW family head-tail joining protein -
NIX71_RS14000 2967702..2969774 - 2073 WP_257755350.1 phage terminase large subunit family protein -
NIX71_RS14005 2969827..2970531 - 705 WP_257755349.1 hypothetical protein -
NIX71_RS14010 2970581..2970826 - 246 WP_251107514.1 hypothetical protein -
NIX71_RS14015 2970975..2971175 - 201 WP_124837747.1 DUF2591 family protein -
NIX71_RS14020 2971181..2971879 - 699 WP_257818528.1 hypothetical protein -
NIX71_RS14025 2971952..2972134 + 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIX71_RS14030 2972161..2972556 + 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIX71_RS14035 2972853..2973284 - 432 WP_157384052.1 hypothetical protein -
NIX71_RS14040 2973277..2973870 - 594 WP_124837745.1 hypothetical protein -
NIX71_RS14045 2974008..2974328 - 321 WP_124837795.1 hypothetical protein -
NIX71_RS14050 2974356..2976155 - 1800 WP_124837793.1 toprim domain-containing protein -
NIX71_RS14055 2976152..2976604 - 453 WP_257818535.1 HNH endonuclease signature motif containing protein -
NIX71_RS14060 2976601..2977482 - 882 WP_257756926.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2884049..2998885 114836


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250346 WP_017922254.1 NZ_CP100244:2971952-2972134 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250346 WP_017922253.1 NZ_CP100244:2972161-2972556 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References