Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 58854..59626 | Replicon | plasmid p22s3p |
Accession | NZ_CP100242 | ||
Organism | Burkholderia glumae strain BGR22S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NIX74_RS31540 | Protein ID | WP_257819017.1 |
Coordinates | 59132..59626 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | NIX74_RS31535 | Protein ID | WP_257819015.1 |
Coordinates | 58854..59135 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX74_RS31525 | 57526..57852 | + | 327 | WP_257819108.1 | hypothetical protein | - |
NIX74_RS31530 | 58161..58577 | + | 417 | WP_257819110.1 | hypothetical protein | - |
NIX74_RS31535 | 58854..59135 | + | 282 | WP_257819015.1 | DUF1778 domain-containing protein | Antitoxin |
NIX74_RS31540 | 59132..59626 | + | 495 | WP_257819017.1 | GNAT family N-acetyltransferase | Toxin |
NIX74_RS31545 | 59718..60191 | + | 474 | WP_257819019.1 | ProQ/FinO family protein | - |
NIX74_RS31550 | 60505..62061 | - | 1557 | WP_012732752.1 | IS66 family transposase | - |
NIX74_RS31555 | 62093..62443 | - | 351 | WP_012732753.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NIX74_RS31560 | 62419..62922 | - | 504 | WP_012732754.1 | transposase | - |
NIX74_RS31565 | 62943..63134 | - | 192 | WP_257819021.1 | transposase | - |
NIX74_RS31570 | 63256..63627 | - | 372 | WP_257819023.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..116826 | 116826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17546.10 Da Isoelectric Point: 9.6894
>T250345 WP_257819017.1 NZ_CP100242:59132-59626 [Burkholderia glumae]
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTPEVAPGRFRRNMPD
PIPVVVLGRLAVDRVHQGNGVGRALVRDAGLRVLHAAATIGIRGLIVHALTDSAKAFYERVGFEASPIDPMLLLITLADL
EHAL
MTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTPEVAPGRFRRNMPD
PIPVVVLGRLAVDRVHQGNGVGRALVRDAGLRVLHAAATIGIRGLIVHALTDSAKAFYERVGFEASPIDPMLLLITLADL
EHAL
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|