Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 3013914..3014518 Replicon chromosome
Accession NZ_CP100238
Organism Burkholderia glumae strain BGR22S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIX74_RS14240 Protein ID WP_017922254.1
Coordinates 3013914..3014096 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIX74_RS14245 Protein ID WP_017922253.1
Coordinates 3014123..3014518 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIX74_RS14210 3009399..3009647 - 249 WP_039201402.1 gpW family head-tail joining protein -
NIX74_RS14215 3009664..3011736 - 2073 WP_257755350.1 phage terminase large subunit family protein -
NIX74_RS14220 3011789..3012493 - 705 WP_257755349.1 hypothetical protein -
NIX74_RS14225 3012543..3012788 - 246 WP_251107514.1 hypothetical protein -
NIX74_RS14230 3012937..3013137 - 201 WP_124837747.1 DUF2591 family protein -
NIX74_RS14235 3013143..3013841 - 699 WP_257818528.1 hypothetical protein -
NIX74_RS14240 3013914..3014096 + 183 WP_017922254.1 type II toxin-antitoxin system HicA family toxin Toxin
NIX74_RS14245 3014123..3014518 + 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIX74_RS14250 3014815..3015246 - 432 WP_157384052.1 hypothetical protein -
NIX74_RS14255 3015239..3015760 - 522 WP_257818531.1 hypothetical protein -
NIX74_RS14260 3015970..3016290 - 321 WP_124837795.1 hypothetical protein -
NIX74_RS14265 3016318..3018117 - 1800 WP_124837793.1 toprim domain-containing protein -
NIX74_RS14270 3018114..3018566 - 453 WP_257818535.1 HNH endonuclease signature motif containing protein -
NIX74_RS14275 3018563..3019444 - 882 WP_257756926.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2927925..3037250 109325
- inside Prophage - - 2875410..3037250 161840


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6599.76 Da        Isoelectric Point: 11.2641

>T250342 WP_017922254.1 NZ_CP100238:3013914-3014096 [Burkholderia glumae]
MNSANLIRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPLGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250342 WP_017922253.1 NZ_CP100238:3014123-3014518 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References