Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 10539..11134 | Replicon | plasmid p19s1p |
| Accession | NZ_CP100235 | ||
| Organism | Burkholderia glumae strain BGR19S | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | C5AN78 |
| Locus tag | NIX15_RS29315 | Protein ID | WP_012734107.1 |
| Coordinates | 10784..11134 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | C5AN79 |
| Locus tag | NIX15_RS29310 | Protein ID | WP_012734108.1 |
| Coordinates | 10539..10790 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIX15_RS29275 | 6158..6355 | + | 198 | WP_127840952.1 | hypothetical protein | - |
| NIX15_RS29280 | 6748..7032 | + | 285 | WP_017432347.1 | hypothetical protein | - |
| NIX15_RS29285 | 7046..7288 | + | 243 | WP_124837682.1 | hypothetical protein | - |
| NIX15_RS29290 | 7285..7530 | + | 246 | WP_127913916.1 | hypothetical protein | - |
| NIX15_RS29295 | 7587..7928 | + | 342 | WP_012732710.1 | hypothetical protein | - |
| NIX15_RS29300 | 7931..9766 | + | 1836 | WP_257811932.1 | site-specific integrase | - |
| NIX15_RS29305 | 9869..10276 | + | 408 | WP_254613402.1 | hypothetical protein | - |
| NIX15_RS29310 | 10539..10790 | + | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIX15_RS29315 | 10784..11134 | + | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIX15_RS29320 | 11193..11387 | + | 195 | WP_124837685.1 | hypothetical protein | - |
| NIX15_RS29325 | 11537..11758 | + | 222 | WP_017433768.1 | hypothetical protein | - |
| NIX15_RS29330 | 11981..12445 | + | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
| NIX15_RS29335 | 12759..15134 | + | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
| NIX15_RS29340 | 15166..15912 | + | 747 | WP_232252306.1 | energy transducer TonB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fliC | 1..225605 | 225605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250341 WP_012734107.1 NZ_CP100235:10784-11134 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MF70 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246MFN5 |