Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1719141..1719916 | Replicon | chromosome |
Accession | NZ_CP100234 | ||
Organism | Burkholderia glumae strain BGR19S |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | C5AIF4 |
Locus tag | NIX15_RS24180 | Protein ID | WP_015877380.1 |
Coordinates | 1719141..1719638 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | C5AIF5 |
Locus tag | NIX15_RS24185 | Protein ID | WP_015877381.1 |
Coordinates | 1719635..1719916 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIX15_RS24145 | 1714595..1715944 | + | 1350 | WP_015877376.1 | allantoin permease | - |
NIX15_RS24150 | 1716030..1716125 | - | 96 | Protein_1365 | IS5/IS1182 family transposase | - |
NIX15_RS24155 | 1716197..1716742 | - | 546 | Protein_1366 | IS3 family transposase | - |
NIX15_RS24160 | 1716865..1717149 | - | 285 | WP_153478924.1 | hypothetical protein | - |
NIX15_RS24165 | 1717166..1717468 | - | 303 | WP_255220127.1 | DUF2380 domain-containing protein | - |
NIX15_RS24170 | 1717544..1718149 | - | 606 | Protein_1369 | RHS repeat-associated core domain-containing protein | - |
NIX15_RS24175 | 1718563..1719060 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
NIX15_RS24180 | 1719141..1719638 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
NIX15_RS24185 | 1719635..1719916 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
NIX15_RS24190 | 1719913..1720290 | - | 378 | WP_173941242.1 | hypothetical protein | - |
NIX15_RS24195 | 1720373..1720735 | - | 363 | WP_017432434.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250339 WP_015877380.1 NZ_CP100234:c1719638-1719141 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC9 |