Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 111841..112478 Replicon plasmid psw2rs4p
Accession NZ_CP100220
Organism Burkholderia glumae strain SW2RS

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIW95_RS33035 Protein ID WP_012735347.1
Coordinates 111841..112242 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIW95_RS33040 Protein ID WP_012735348.1
Coordinates 112242..112478 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW95_RS33005 108304..108573 + 270 WP_012735343.1 hypothetical protein -
NIW95_RS33010 108733..109347 + 615 Protein_99 error-prone DNA polymerase -
NIW95_RS33015 109363..109650 + 288 WP_012735344.1 hypothetical protein -
NIW95_RS33020 110754..110948 - 195 WP_124837731.1 hypothetical protein -
NIW95_RS33025 111003..111245 - 243 WP_012735345.1 hypothetical protein -
NIW95_RS33030 111263..111826 - 564 WP_012735346.1 hypothetical protein -
NIW95_RS33035 111841..112242 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIW95_RS33040 112242..112478 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIW95_RS33045 112815..113504 - 690 WP_257739423.1 hypothetical protein -
NIW95_RS33050 113591..115417 - 1827 WP_012735349.1 site-specific integrase -
NIW95_RS33055 115414..115794 - 381 WP_080569442.1 hypothetical protein -
NIW95_RS33060 115797..116114 - 318 WP_050811486.1 hypothetical protein -
NIW95_RS33065 116165..117253 - 1089 Protein_110 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..128914 128914


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250330 WP_012735347.1 NZ_CP100220:c112242-111841 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250330 WP_012735348.1 NZ_CP100220:c112478-112242 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References