Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1694024..1694799 | Replicon | chromosome |
Accession | NZ_CP100216 | ||
Organism | Burkholderia glumae strain SW2RS |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | C5AIF4 |
Locus tag | NIW95_RS25425 | Protein ID | WP_015877380.1 |
Coordinates | 1694024..1694521 (-) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | C5AIF5 |
Locus tag | NIW95_RS25430 | Protein ID | WP_015877381.1 |
Coordinates | 1694518..1694799 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIW95_RS25390 | 1690045..1690140 | - | 96 | Protein_1327 | IS5/IS1182 family transposase | - |
NIW95_RS25395 | 1690212..1690757 | - | 546 | Protein_1328 | IS3 family transposase | - |
NIW95_RS25400 | 1690950..1691755 | + | 806 | WP_085962370.1 | IS5 family transposase | - |
NIW95_RS25405 | 1691721..1692032 | - | 312 | WP_015877377.1 | hypothetical protein | - |
NIW95_RS25410 | 1692049..1692351 | - | 303 | WP_255220127.1 | DUF2380 domain-containing protein | - |
NIW95_RS25415 | 1692427..1693032 | - | 606 | Protein_1332 | RHS repeat-associated core domain-containing protein | - |
NIW95_RS25420 | 1693446..1693943 | - | 498 | WP_015877379.1 | ProQ/FINO family protein | - |
NIW95_RS25425 | 1694024..1694521 | - | 498 | WP_015877380.1 | GNAT family N-acetyltransferase | Toxin |
NIW95_RS25430 | 1694518..1694799 | - | 282 | WP_015877381.1 | DUF1778 domain-containing protein | Antitoxin |
NIW95_RS25435 | 1694796..1695173 | - | 378 | WP_173941242.1 | hypothetical protein | - |
NIW95_RS25440 | 1695256..1695618 | - | 363 | WP_017432434.1 | hypothetical protein | - |
NIW95_RS25445 | 1695627..1699754 | - | 4128 | WP_275995111.1 | RHS repeat-associated core domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fliC | 1678031..1720347 | 42316 | |
- | flank | IS/Tn | - | - | 1690188..1690730 | 542 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17544.11 Da Isoelectric Point: 9.6894
>T250327 WP_015877380.1 NZ_CP100216:c1694521-1694024 [Burkholderia glumae]
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
VTGWRAPEPLSDAHGLDDFDSGVASLDTWLKRRALANQRSGASRTFVATRDGRVGAYYALASGAVTLEVAPGRFRRNMPD
PIPVVVLGRLAVDRAHQGIGVGRALVRDAGLRVLHAAAAIGIRGLIVHALSDSAKAFYERVGFEASPLDPMLLLITLADL
EHALS
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9HNC9 |