Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 122925..123562 | Replicon | plasmid pew10rs4p |
| Accession | NZ_CP100214 | ||
| Organism | Burkholderia glumae strain EW10RS | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | C5AP38 |
| Locus tag | NIW91_RS33070 | Protein ID | WP_012735347.1 |
| Coordinates | 122925..123326 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | C5AP39 |
| Locus tag | NIW91_RS33075 | Protein ID | WP_012735348.1 |
| Coordinates | 123326..123562 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIW91_RS33040 | 119388..119657 | + | 270 | WP_012735343.1 | hypothetical protein | - |
| NIW91_RS33045 | 119817..120431 | + | 615 | Protein_107 | error-prone DNA polymerase | - |
| NIW91_RS33050 | 120447..120734 | + | 288 | WP_012735344.1 | hypothetical protein | - |
| NIW91_RS33055 | 121838..122032 | - | 195 | WP_124837731.1 | hypothetical protein | - |
| NIW91_RS33060 | 122087..122329 | - | 243 | WP_012735345.1 | hypothetical protein | - |
| NIW91_RS33065 | 122347..122910 | - | 564 | WP_012735346.1 | hypothetical protein | - |
| NIW91_RS33070 | 122925..123326 | - | 402 | WP_012735347.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIW91_RS33075 | 123326..123562 | - | 237 | WP_012735348.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIW91_RS33080 | 123899..124588 | - | 690 | WP_257739423.1 | hypothetical protein | - |
| NIW91_RS33085 | 124675..126501 | - | 1827 | WP_012735349.1 | site-specific integrase | - |
| NIW91_RS33090 | 126498..126878 | - | 381 | WP_080569442.1 | hypothetical protein | - |
| NIW91_RS33095 | 126881..127198 | - | 318 | WP_050811486.1 | hypothetical protein | - |
| NIW91_RS33100 | 127249..128337 | - | 1089 | Protein_118 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..128913 | 128913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14847.12 Da Isoelectric Point: 5.2138
>T250326 WP_012735347.1 NZ_CP100214:c123326-122925 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|