Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-ChpS
Location 124865..125460 Replicon plasmid pew10rs1p
Accession NZ_CP100211
Organism Burkholderia glumae strain EW10RS

Toxin (Protein)


Gene name chpB Uniprot ID C5AN78
Locus tag NIW91_RS31135 Protein ID WP_012734107.1
Coordinates 124865..125215 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID C5AN79
Locus tag NIW91_RS31140 Protein ID WP_012734108.1
Coordinates 125209..125460 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW91_RS31110 120087..120833 - 747 WP_232252306.1 energy transducer TonB -
NIW91_RS31115 120865..123240 - 2376 WP_232252305.1 TonB-dependent receptor -
NIW91_RS31120 123554..124018 - 465 WP_012734106.1 Lrp/AsnC family transcriptional regulator -
NIW91_RS31125 124241..124462 - 222 WP_017433768.1 hypothetical protein -
NIW91_RS31130 124612..124806 - 195 WP_124837685.1 hypothetical protein -
NIW91_RS31135 124865..125215 - 351 WP_012734107.1 type II toxin-antitoxin system ChpB family toxin Toxin
NIW91_RS31140 125209..125460 - 252 WP_012734108.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIW91_RS31145 125723..126130 - 408 WP_230674618.1 hypothetical protein -
NIW91_RS31150 126233..128068 - 1836 WP_012732711.1 site-specific integrase -
NIW91_RS31155 128071..128412 - 342 WP_012732710.1 hypothetical protein -
NIW91_RS31160 128469..128714 - 246 WP_127913916.1 hypothetical protein -
NIW91_RS31165 128711..128953 - 243 WP_124837682.1 hypothetical protein -
NIW91_RS31170 128967..129251 - 285 WP_017432347.1 hypothetical protein -
NIW91_RS31175 129639..129956 - 318 WP_148271069.1 hypothetical protein -
NIW91_RS31180 130140..130421 - 282 WP_043308454.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..132942 132942


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(8-114)

Antitoxin

Antitoxin PemI-like

(1-83)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12389.37 Da        Isoelectric Point: 8.8909

>T250324 WP_012734107.1 NZ_CP100211:c125215-124865 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 8940.31 Da        Isoelectric Point: 6.2420

>AT250324 WP_012734108.1 NZ_CP100211:c125460-125209 [Burkholderia glumae]
MELKIQKWGNSAAVRLPSVLLEQINASVGGSLNADVRPDGVLLTPARRKYALDDLVAQCDTKAPVPADMAAWGEIKPVGR
EAW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246MF70

Antitoxin

Source ID Structure
AlphaFold DB A0A246MFN5

References