Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 122923..123560 Replicon plasmid perw1rs4p
Accession NZ_CP100202
Organism Burkholderia glumae strain PERW1RS

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIW82_RS33085 Protein ID WP_012735347.1
Coordinates 122923..123324 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIW82_RS33090 Protein ID WP_012735348.1
Coordinates 123324..123560 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW82_RS33055 119386..119655 + 270 WP_012735343.1 hypothetical protein -
NIW82_RS33060 119815..120429 + 615 Protein_108 error-prone DNA polymerase -
NIW82_RS33065 120445..120732 + 288 WP_012735344.1 hypothetical protein -
NIW82_RS33070 121836..122030 - 195 WP_124837731.1 hypothetical protein -
NIW82_RS33075 122085..122327 - 243 WP_012735345.1 hypothetical protein -
NIW82_RS33080 122345..122908 - 564 WP_012735346.1 hypothetical protein -
NIW82_RS33085 122923..123324 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIW82_RS33090 123324..123560 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIW82_RS33095 123897..124586 - 690 WP_257739423.1 hypothetical protein -
NIW82_RS33100 124673..126499 - 1827 WP_012735349.1 site-specific integrase -
NIW82_RS33105 126496..126876 - 381 WP_080569442.1 hypothetical protein -
NIW82_RS33110 126879..127196 - 318 WP_050811486.1 hypothetical protein -
NIW82_RS33115 127247..128335 - 1089 Protein_119 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..128912 128912


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250318 WP_012735347.1 NZ_CP100202:c123324-122923 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250318 WP_012735348.1 NZ_CP100202:c123560-123324 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References