Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 11254..11849 | Replicon | plasmid p947s2p |
Accession | NZ_CP100189 | ||
Organism | Burkholderia glumae strain SL-947S |
Toxin (Protein)
Gene name | chpB | Uniprot ID | C5AN78 |
Locus tag | NIW76_RS29970 | Protein ID | WP_012734107.1 |
Coordinates | 11499..11849 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | C5AN79 |
Locus tag | NIW76_RS29965 | Protein ID | WP_012734108.1 |
Coordinates | 11254..11505 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIW76_RS29930 | 6523..6711 | + | 189 | WP_017432455.1 | hypothetical protein | - |
NIW76_RS29935 | 7463..7747 | + | 285 | WP_017432347.1 | hypothetical protein | - |
NIW76_RS29940 | 7761..8003 | + | 243 | WP_124837682.1 | hypothetical protein | - |
NIW76_RS29945 | 8000..8245 | + | 246 | WP_127913916.1 | hypothetical protein | - |
NIW76_RS29950 | 8302..8643 | + | 342 | WP_012732710.1 | hypothetical protein | - |
NIW76_RS29955 | 8646..10481 | + | 1836 | WP_012732711.1 | site-specific integrase | - |
NIW76_RS29960 | 10584..10991 | + | 408 | WP_230674618.1 | hypothetical protein | - |
NIW76_RS29965 | 11254..11505 | + | 252 | WP_012734108.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NIW76_RS29970 | 11499..11849 | + | 351 | WP_012734107.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
NIW76_RS29975 | 11908..12102 | + | 195 | WP_124837685.1 | hypothetical protein | - |
NIW76_RS29980 | 12252..12473 | + | 222 | WP_017433768.1 | hypothetical protein | - |
NIW76_RS29985 | 12695..13159 | + | 465 | WP_012734106.1 | Lrp/AsnC family transcriptional regulator | - |
NIW76_RS29990 | 13473..15848 | + | 2376 | WP_232252305.1 | TonB-dependent receptor | - |
NIW76_RS29995 | 15880..16626 | + | 747 | WP_232252306.1 | energy transducer TonB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..128913 | 128913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12389.37 Da Isoelectric Point: 8.8909
>T250310 WP_012734107.1 NZ_CP100189:11499-11849 [Burkholderia glumae]
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
MVKRVKFERGDIVRVSLSPTVGREQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARFAGFAVPLSGSGTETQGVALV
NMVRMLDLEGRGARKIERAPVEVVEDALARLQTIIE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MF70 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A246MFN5 |