Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1582136..1582740 Replicon chromosome
Accession NZ_CP100186
Organism Burkholderia glumae strain SL-947S

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NIW76_RS07250 Protein ID WP_257744545.1
Coordinates 1582558..1582740 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NIW76_RS07245 Protein ID WP_017922253.1
Coordinates 1582136..1582531 (-) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW76_RS07210 1577140..1577355 + 216 WP_155296969.1 hypothetical protein -
NIW76_RS07215 1577355..1578305 + 951 WP_155296968.1 helix-turn-helix domain-containing protein -
NIW76_RS07220 1578302..1580044 + 1743 WP_052231208.1 toprim domain-containing protein -
NIW76_RS07225 1580064..1580573 + 510 WP_257744542.1 hypothetical protein -
NIW76_RS07230 1580620..1580838 + 219 WP_017922250.1 hypothetical protein -
NIW76_RS07235 1580852..1581415 + 564 WP_257744543.1 hypothetical protein -
NIW76_RS07240 1581408..1581839 + 432 WP_257744544.1 hypothetical protein -
NIW76_RS07245 1582136..1582531 - 396 WP_017922253.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIW76_RS07250 1582558..1582740 - 183 WP_257744545.1 type II toxin-antitoxin system HicA family toxin Toxin
NIW76_RS07255 1582891..1583511 + 621 WP_257744546.1 hypothetical protein -
NIW76_RS07260 1583517..1583879 + 363 WP_257744547.1 DUF2591 domain-containing protein -
NIW76_RS07265 1583866..1584111 + 246 WP_257744548.1 hypothetical protein -
NIW76_RS07270 1584161..1584865 + 705 WP_251108520.1 hypothetical protein -
NIW76_RS07275 1584918..1586990 + 2073 WP_017922258.1 phage terminase large subunit family protein -
NIW76_RS07280 1587007..1587255 + 249 WP_017922259.1 gpW family head-tail joining protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1568838..1611364 42526


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-123)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6614.73 Da        Isoelectric Point: 11.2641

>T250307 WP_257744545.1 NZ_CP100186:c1582740-1582558 [Burkholderia glumae]
MNSANLLRTLKADGWYLVNTVGSHHQFKHATKPGKVTVPHPKKDLPQGTVRSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 14466.21 Da        Isoelectric Point: 4.5532

>AT250307 WP_017922253.1 NZ_CP100186:c1582531-1582136 [Burkholderia glumae]
MLYPLYVHVGDDKHAHGVTFPDFPGCHAAADSWDELPAAVQEAAQAHFEGDDSPIPEPSALEDLTRDPEYTGGVWMIFDI
DLSKINTKAVRFNVSMSERLLQKIDAKARARKLSRSAFLAIAAEHEMEADA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References