Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-vagC/VapC-VagC
Location 21797..22434 Replicon plasmid pR53p
Accession NZ_CP100185
Organism Burkholderia glumae strain R5

Toxin (Protein)


Gene name vapC Uniprot ID C5AP38
Locus tag NIW68_RS31040 Protein ID WP_012735347.1
Coordinates 21797..22198 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID C5AP39
Locus tag NIW68_RS31045 Protein ID WP_012735348.1
Coordinates 22198..22434 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW68_RS31010 18260..18529 + 270 WP_012735343.1 hypothetical protein -
NIW68_RS31015 18689..19303 + 615 Protein_17 error-prone DNA polymerase -
NIW68_RS31020 19319..19606 + 288 WP_012735344.1 hypothetical protein -
NIW68_RS31025 20710..20904 - 195 WP_124837731.1 hypothetical protein -
NIW68_RS31030 20959..21201 - 243 WP_012735345.1 hypothetical protein -
NIW68_RS31035 21219..21782 - 564 WP_012735346.1 hypothetical protein -
NIW68_RS31040 21797..22198 - 402 WP_012735347.1 type II toxin-antitoxin system VapC family toxin Toxin
NIW68_RS31045 22198..22434 - 237 WP_012735348.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIW68_RS31050 22771..23460 - 690 WP_257739423.1 hypothetical protein -
NIW68_RS31055 23547..25373 - 1827 WP_012735349.1 site-specific integrase -
NIW68_RS31060 25370..25750 - 381 WP_080569442.1 hypothetical protein -
NIW68_RS31065 25753..26070 - 318 WP_050811486.1 hypothetical protein -
NIW68_RS31070 26121..27209 - 1089 Protein_28 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..52685 52685


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-117)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14847.12 Da        Isoelectric Point: 5.2138

>T250306 WP_012735347.1 NZ_CP100185:c22198-21797 [Burkholderia glumae]
MPRFMLDTNMCIYLMKNQPEQVAKRFAECFVGDVVMSAITYAELEYGVAVSDNRAKERRNLAALIEDILVAPFDAAAAVA
YGPIREATRERKKDHLDKLIAAHAVALDVVLVTNNAKDFASYPGIKLDNWLND

Download         Length: 402 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8983.13 Da        Isoelectric Point: 6.3676

>AT250306 WP_012735348.1 NZ_CP100185:c22434-22198 [Burkholderia glumae]
MQTTRVFRNGNSQAVRIPADLAYERSDVELEIERVGDEIRIRPARRPLTGVLKKFAKFSQDFMAEGRGEQEQAEREGM

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB C5AP38

Antitoxin

Source ID Structure
AlphaFold DB C5AP39

References