Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 157860..158509 Replicon plasmid pR52p
Accession NZ_CP100184
Organism Burkholderia glumae strain R5

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NIW68_RS30850 Protein ID WP_257806654.1
Coordinates 157860..158270 (-) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NIW68_RS30855 Protein ID WP_257806656.1
Coordinates 158267..158509 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIW68_RS30805 153100..153336 - 237 WP_012735334.1 helix-turn-helix transcriptional regulator -
NIW68_RS30810 153519..153695 + 177 WP_257820135.1 transposase -
NIW68_RS30815 153806..154003 - 198 WP_257820136.1 hypothetical protein -
NIW68_RS30820 154119..155960 - 1842 WP_257820138.1 site-specific integrase -
NIW68_RS30825 155957..156337 - 381 WP_176359110.1 hypothetical protein -
NIW68_RS30830 156372..156689 - 318 WP_257820140.1 hypothetical protein -
NIW68_RS30835 156752..157162 - 411 WP_257820142.1 type II toxin-antitoxin system VapC family toxin -
NIW68_RS30840 157153..157407 - 255 WP_012734091.1 antitoxin -
NIW68_RS30845 157588..157788 - 201 WP_257806653.1 hypothetical protein -
NIW68_RS30850 157860..158270 - 411 WP_257806654.1 type II toxin-antitoxin system VapC family toxin Toxin
NIW68_RS30855 158267..158509 - 243 WP_257806656.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NIW68_RS30860 158928..159263 + 336 WP_252836630.1 metalloregulator ArsR/SmtB family transcription factor -
NIW68_RS30865 159260..159738 + 479 Protein_164 ArsI/CadI family heavy metal resistance metalloenzyme -
NIW68_RS30870 159748..160242 + 495 WP_252836631.1 arsenate reductase ArsC -
NIW68_RS30875 160259..160753 + 495 WP_252836632.1 arsenate reductase ArsC -
NIW68_RS30880 160818..161891 + 1074 WP_252836633.1 ACR3 family arsenite efflux transporter -
NIW68_RS30885 161893..163131 + 1239 WP_252836634.1 MFS transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..172554 172554


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(12-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14762.07 Da        Isoelectric Point: 5.6956

>T250305 WP_257806654.1 NZ_CP100184:c158270-157860 [Burkholderia glumae]
MTLYLLDTNILSSVIRDPRGACATRIGHTQPEQICTSIIVAAELRFGVFKRGSPTLAQRVEQLLASLSVLPLQPDADQCY
GRLRADLEKQGQLIGANDMLIAAHALALEAVLVTDNTAEFARVAGLPVENWLRPTP

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9195.39 Da        Isoelectric Point: 4.6234

>AT250305 WP_257806656.1 NZ_CP100184:c158509-158267 [Burkholderia glumae]
MPAHDTRHARLFRNGRSQAVRIPREFELSASEVTIYREGARLIIEPVQAAPLRELFAQWTPLDETFPDIENLPAEPVDIE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References