Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-MazE |
| Location | 122202..122797 | Replicon | plasmid pR52p |
| Accession | NZ_CP100184 | ||
| Organism | Burkholderia glumae strain R5 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | NIW68_RS30625 | Protein ID | WP_257820096.1 |
| Coordinates | 122202..122552 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | - |
| Locus tag | NIW68_RS30630 | Protein ID | WP_257820098.1 |
| Coordinates | 122546..122797 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIW68_RS30580 | 118560..118790 | - | 231 | WP_257820078.1 | hypothetical protein | - |
| NIW68_RS30585 | 118849..119058 | - | 210 | WP_257820080.1 | hypothetical protein | - |
| NIW68_RS30590 | 119099..119473 | - | 375 | WP_257820082.1 | site-specific integrase | - |
| NIW68_RS30595 | 119668..120054 | - | 387 | WP_257820084.1 | hypothetical protein | - |
| NIW68_RS30600 | 120111..120494 | - | 384 | WP_257820086.1 | hypothetical protein | - |
| NIW68_RS30605 | 120527..120919 | - | 393 | WP_257820088.1 | hypothetical protein | - |
| NIW68_RS30610 | 121077..121385 | - | 309 | WP_257820090.1 | hypothetical protein | - |
| NIW68_RS30615 | 121713..122000 | - | 288 | WP_257820092.1 | hypothetical protein | - |
| NIW68_RS30620 | 122013..122189 | - | 177 | WP_257820094.1 | hypothetical protein | - |
| NIW68_RS30625 | 122202..122552 | - | 351 | WP_257820096.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NIW68_RS30630 | 122546..122797 | - | 252 | WP_257820098.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NIW68_RS30635 | 122945..125266 | - | 2322 | WP_257820100.1 | site-specific integrase | - |
| NIW68_RS30640 | 125268..126089 | - | 822 | WP_257820102.1 | hypothetical protein | - |
| NIW68_RS30645 | 126086..126415 | - | 330 | WP_257820104.1 | hypothetical protein | - |
| NIW68_RS30650 | 126497..127294 | - | 798 | WP_012732720.1 | IS21-like element helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..172554 | 172554 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12376.33 Da Isoelectric Point: 8.6592
>T250304 WP_257820096.1 NZ_CP100184:c122552-122202 [Burkholderia glumae]
MVKRVKFERGDIVRVGLNPTMGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLEARGARKVERAPVEVVEDALARLQTILE
MVKRVKFERGDIVRVGLNPTMGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLEARGARKVERAPVEVVEDALARLQTILE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|