Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2023171..2023846 | Replicon | chromosome |
| Accession | NZ_CP100182 | ||
| Organism | Burkholderia glumae strain R5 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NIW68_RS25420 | Protein ID | WP_251119048.1 |
| Coordinates | 2023171..2023356 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NIW68_RS25425 | Protein ID | WP_257757920.1 |
| Coordinates | 2023427..2023846 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIW68_RS25375 | 2018897..2019352 | - | 456 | WP_251119056.1 | hypothetical protein | - |
| NIW68_RS25380 | 2019349..2019918 | - | 570 | WP_257806295.1 | hypothetical protein | - |
| NIW68_RS25385 | 2019921..2020583 | - | 663 | WP_257806296.1 | KilA-N domain-containing protein | - |
| NIW68_RS25390 | 2020583..2020804 | - | 222 | WP_257806297.1 | hypothetical protein | - |
| NIW68_RS25395 | 2020797..2021075 | - | 279 | WP_257806298.1 | hypothetical protein | - |
| NIW68_RS25400 | 2021068..2021385 | - | 318 | WP_257806299.1 | hypothetical protein | - |
| NIW68_RS25405 | 2021467..2021652 | - | 186 | WP_257806301.1 | hypothetical protein | - |
| NIW68_RS25410 | 2021649..2022419 | - | 771 | WP_257806303.1 | KilA-N domain-containing protein | - |
| NIW68_RS25415 | 2022537..2022995 | + | 459 | WP_257806304.1 | Arc family DNA-binding protein | - |
| NIW68_RS25420 | 2023171..2023356 | + | 186 | WP_251119048.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIW68_RS25425 | 2023427..2023846 | + | 420 | WP_257757920.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIW68_RS25430 | 2023958..2024428 | - | 471 | WP_257819932.1 | P63C domain-containing protein | - |
| NIW68_RS25435 | 2024488..2025285 | - | 798 | WP_012732720.1 | IS21-like element helper ATPase IstB | - |
| NIW68_RS25440 | 2025278..2026783 | - | 1506 | WP_012732721.1 | IS21 family transposase | - |
| NIW68_RS25445 | 2026851..2027528 | + | 678 | WP_257819934.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2005553..2032698 | 27145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6934.04 Da Isoelectric Point: 10.7447
>T250301 WP_251119048.1 NZ_CP100182:2023171-2023356 [Burkholderia glumae]
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
MKYSEFRKWLKKQGAEFEKHKSGSSHFRVTLNGKTTIFPDHGSKEIGTGLVEAIKKQLGIK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15012.52 Da Isoelectric Point: 5.7642
>AT250301 WP_257757920.1 NZ_CP100182:2023427-2023846 [Burkholderia glumae]
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAAPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
MLSYPVTLTPDSNGTLLVTFPDVPEAISVGENVEDALAQGLDALEAAFEIYFNEKRLIPAPSQAAPGQHVVTLPVLVASK
VLLANEAIEQKVRKAELARRLKVAPVQVDRLFKFSHGSKIEMIEAALGVLGKRLEIKAV
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|